PDB entry 3wja

View 3wja on RCSB PDB site
Description: The crystal structure of human cytosolic NADP(+)-dependent malic enzyme in apo form
Class: oxidoreductase
Keywords: NADP(+)-binding Rossmann-fold domains, oxidoreductase activity, metal ion binding, OXIDOREDUCTASE
Deposited on 2013-10-08, released 2014-08-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.183
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADP-dependent malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: ME1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3wjaa1, d3wjaa2
  • Chain 'B':
    Compound: NADP-dependent malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: ME1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3wjab1, d3wjab2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wjaA (A:)
    mepeaprrrhthqrgylltrnphlnkdlaftleerqqlnihgllppsfnsqeiqvlrvvk
    nfehlnsdfdrylllmdlqdrneklfyrvltsdiekfmpivytptvglacqqyslvfrkp
    rglfitihdrghiasvlnawpedvikaivvtdgerilglgdlgcngmgipvgklalytac
    ggmnpqeclpvildvgteneellkdplyiglrqrrvrgseyddfldefmeavsskygmnc
    liqfedfanvnafrllnkyrnqyctfnddiqgtasvavagllaalritknklsdqtilfq
    gageaalgiahlivmalekeglpkekaikkiwlvdskglivkgrasltqekekfahehee
    mknleaivqeikptaligvaaiggafseqilkdmaafnerpiifalsnptskaecsaeqc
    ykitkgraifasgspfdpvtlpngqtlypgqgnnsyvfpgvalgvvacglrqitdniflt
    taeviaqqvsdkhleegrlypplntirdvslkiaekivkdayqektatvypepqnkeafv
    rsqmystdydqilpdcyswpeevqkiqtkvdqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wjaA (A:)
    rrhthqrgylltrnphlnkdlaftleerqqlnihgllppsfnsqeiqvlrvvknfehlns
    dfdrylllmdlqdrneklfyrvltsdiekfmpivytptvglacqqyslvfrkprglfiti
    hdrghiasvlnawpedvikaivvtdgerilglgdlgcngmgipvgklalytacggmnpqe
    clpvildvgteneellkdplyiglrqrrvrgseyddfldefmeavsskygmncliqfedf
    anvnafrllnkyrnqyctfnddiqgtasvavagllaalritknklsdqtilfqgageaal
    giahlivmalekeglpkekaikkiwlvdskglivkgrasltqekekfaheheemknleai
    vqeikptaligvaaiggafseqilkdmaafnerpiifalsnptskaecsaeqcykitkgr
    aifasgspfdpvtlpngqtlypgqgnnsyvfpgvalgvvacglrqitdniflttaeviaq
    qvsdkhleegrlypplntirdvslkiaekivkdayqektatvypepqnkeafvrsqmyst
    dydqilpdcyswpeevqkiqtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wjaB (B:)
    mepeaprrrhthqrgylltrnphlnkdlaftleerqqlnihgllppsfnsqeiqvlrvvk
    nfehlnsdfdrylllmdlqdrneklfyrvltsdiekfmpivytptvglacqqyslvfrkp
    rglfitihdrghiasvlnawpedvikaivvtdgerilglgdlgcngmgipvgklalytac
    ggmnpqeclpvildvgteneellkdplyiglrqrrvrgseyddfldefmeavsskygmnc
    liqfedfanvnafrllnkyrnqyctfnddiqgtasvavagllaalritknklsdqtilfq
    gageaalgiahlivmalekeglpkekaikkiwlvdskglivkgrasltqekekfahehee
    mknleaivqeikptaligvaaiggafseqilkdmaafnerpiifalsnptskaecsaeqc
    ykitkgraifasgspfdpvtlpngqtlypgqgnnsyvfpgvalgvvacglrqitdniflt
    taeviaqqvsdkhleegrlypplntirdvslkiaekivkdayqektatvypepqnkeafv
    rsqmystdydqilpdcyswpeevqkiqtkvdqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wjaB (B:)
    rrhthqrgylltrnphlnkdlaftleerqqlnihgllppsfnsqeiqvlrvvknfehlns
    dfdrylllmdlqdrneklfyrvltsdiekfmpivytptvglacqqyslvfrkprglfiti
    hdrghiasvlnawpedvikaivvtdgerilglgdlgcngmgipvgklalytacggmnpqe
    clpvildvgteneellkdplyiglrqrrvrgseyddfldefmeavsskygmncliqfedf
    anvnafrllnkyrnqyctfnddiqgtasvavagllaalritknklsdqtilfqgageaal
    giahlivmalekeglpkekaikkiwlvdskglivkgrasltqekekfaheheemknleai
    vqeikptaligvaaiggafseqilkdmaafnerpiifalsnptskaecsaeqcykitkgr
    aifasgspfdpvtlpngqtlypgqgnnsyvfpgvalgvvacglrqitdniflttaeviaq
    qvsdkhleegrlypplntirdvslkiaekivkdayqektatvypepqnkeafvrsqmyst
    dydqilpdcyswpeevqkiqtkv