PDB entry 3wj4

View 3wj4 on RCSB PDB site
Description: Crystal structure of PPARgamma ligand binding domain in complex with tributyltin
Class: transcription
Keywords: protein-ligand complex, DNA-binding, Metal-binding, Nucleus, Receptor, Transcription
Deposited on 2013-10-04, released 2014-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.196
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (5-End)
      • expression tag (3-4)
    Domains in SCOPe 2.07: d3wj4a1, d3wj4a2
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (5-End)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d3wj4b1, d3wj4b2
  • Heterogens: TBY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wj4A (A:)
    gplgsesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedk
    ikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkyg
    vheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldd
    sdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtd
    lrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wj4A (A:)
    gsesadlralakhlydsyiksfpltkakarailtgkkspfviydmnslmmgedkiskeva
    irifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdg
    vlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrp
    gllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikk
    tetdmslhpllqeiyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wj4B (B:)
    gplgsesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedk
    ikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkyg
    vheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldd
    sdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtd
    lrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wj4B (B:)
    gplgsesadlralakhlydsyiksfpltkakarailtgkkspfviydmnslmmgedkikf
    khkevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlas
    lmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiavii
    lsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvql
    lqvikktetdhpllqeiykd