PDB entry 3wht

View 3wht on RCSB PDB site
Description: Crystal structure of ERGIC-53/MCFD2, Calcium-free form
Class: protein transport
Keywords: Beta-sandwich, EF-hand, Cargo receptor, Calcium binding, ER, ERGIC, PROTEIN TRANSPORT
Deposited on 2013-08-30, released 2014-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein ERGIC-53
    Species: Homo sapiens [TaxId:9606]
    Gene: ERGIC53
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3whta_
  • Chain 'B':
    Compound: multiple coagulation factor deficiency protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MCFD2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3whtA (A:)
    mnhkvhmdgvggdpavalphrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirva
    pslksqrgsvwtktkaafenwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadl
    wngvgiffdsfdndgkknnpaiviignngqihydhqndgasqalascqrdfrnkpypvra
    kityyqntltvminngftpdkndyefcakvenmiipaqghfgisaatggladdhdvlsfl
    tfqlte
    

    Sequence, based on observed residues (ATOM records): (download)
    >3whtA (A:)
    rrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaafen
    wevevtfrvtgrgrigadglaiwyaenqglegpvfgsadlwngvgiffdsfnpaiviign
    ngqihalascqrdfrnkpypvrakityyqntltvminngftpdkndyefcakvenmiipa
    qghfgisaatggladdhdvlsfltfqlt
    

  • Chain 'B':
    No sequence available.