PDB entry 3whb

View 3whb on RCSB PDB site
Description: Crystal structure of FadR from Bacillus subtilis, a transcriptional regulator involved in the regulation of fatty acid degradation
Class: transcription
Keywords: transcriptional regulator, fatty acid degradation, TRANSCRIPTION
Deposited on 2013-08-23, released 2014-03-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fatty acid metabolism regulator protein
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: fadR, ysiA, BSU28550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3whba1, d3whba2
  • Chain 'B':
    Compound: fatty acid metabolism regulator protein
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: fadR, ysiA, BSU28550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3whbb1, d3whbb2
  • Heterogens: DCC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3whbA (A:)
    mkqkrpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfke
    kmgqfiermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkin
    eilkgylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvals
    nsvlellvsgihnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3whbA (A:)
    rpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmgq
    fiermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilk
    gylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvl
    ellvsgihn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3whbB (B:)
    mkqkrpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfke
    kmgqfiermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkin
    eilkgylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvals
    nsvlellvsgihnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3whbB (B:)
    pkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmgqf
    iermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkg
    ylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvle
    llvsgih