PDB entry 3wgp

View 3wgp on RCSB PDB site
Description: Crystal Structure Analysis of Vitamin D receptor
Class: hormone receptor
Keywords: Steroid hormon receptor family member, HORMONE RECEPTOR
Deposited on 2013-08-07, released 2014-08-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-27, with a file datestamp of 2014-08-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Vdr, Nr1i1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wgpa_
  • Heterogens: ED9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wgpA (A:)
    lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
    adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
    qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
    lieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpec
    smkltplvlevfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wgpA (A:)
    lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
    adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
    qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
    lieaiqdrlsntlqtyircrhpppllyakmiqkladlrslneehskqyrclsfqpecsmk
    ltplvlevfg