PDB entry 3wgk

View 3wgk on RCSB PDB site
Description: STAPHYLOCOCCUS AUREUS FTSZ T7 mutant substituted for GAG, DeltaT7GAG-GDP
Class: cell cycle
Keywords: FTSZ, GTP-BINDING, TUBULIN HOMOLOG, POLYMERIZATION, GTPase, CELL DIVISION, CELL CYCLE
Deposited on 2013-08-06, released 2013-12-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.204
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A029
      • see remark 999 (205-207)
    Domains in SCOPe 2.06: d3wgka1, d3wgka2
  • Chain 'B':
    Compound: cell division protein ftsz
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A029
      • see remark 999 (205-207)
    Domains in SCOPe 2.06: d3wgkb1, d3wgkb2
  • Heterogens: GDP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wgkA (A:)
    ghmlefeqgfnhlatlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaesk
    iqigekltrglgaganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvva
    kiakemgaltvgvvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstp
    mmeafkeadnvlrqgvqgisdliavgagldfadvktimsnqgsalmgigvssgenravea
    akkaissplletsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinp
    elqdeivvtviatgfddkptshgrksgstgfgtsvntssnatskdesftsnssnaqatds
    vserthttkeddipsfirnreerrsrrtrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wgkA (A:)
    latlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglg
    aganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvg
    vvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvl
    rqgvqgisdliavgagldfadvktimsnqgsalmgigvssgenraveaakkaisspllet
    sivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtvia
    tgfd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wgkB (B:)
    ghmlefeqgfnhlatlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaesk
    iqigekltrglgaganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvva
    kiakemgaltvgvvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstp
    mmeafkeadnvlrqgvqgisdliavgagldfadvktimsnqgsalmgigvssgenravea
    akkaissplletsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinp
    elqdeivvtviatgfddkptshgrksgstgfgtsvntssnatskdesftsnssnaqatds
    vserthttkeddipsfirnreerrsrrtrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wgkB (B:)
    latlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglg
    aganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvg
    vvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvl
    rqgvqgisdliavgagldfadvktimsnqgsalmgigvssgenraveaakkaisspllet
    sivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtvia
    tgfd