PDB entry 3wgj

View 3wgj on RCSB PDB site
Description: STAPHYLOCOCCUS AUREUS FTSZ T7 chimera mutant, T7Bs
Class: cell cycle
Keywords: ftsz, GTP-binding, tubulin homolog, polymerization, gtpase, cell division, cell cycle
Deposited on 2013-08-06, released 2013-12-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.188
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A029 (3-End)
      • engineered mutation (194-195)
      • engineered mutation (197-198)
    Domains in SCOPe 2.06: d3wgja1, d3wgja2
  • Chain 'B':
    Compound: cell division protein ftsz
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A029 (3-End)
      • engineered mutation (194-195)
      • engineered mutation (197-198)
    Domains in SCOPe 2.06: d3wgjb1
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wgjA (A:)
    ghmatlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrg
    lgaganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgalt
    vgvvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadn
    vlrqgvqgisdliatpglinldfadvktimsnqgsalmgigvssgenraveaakkaissp
    lletsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivv
    tviatgfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wgjA (A:)
    atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
    ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
    vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
    qgvqgisdliatpglinldfadvktimsnqgsalmgigvssgenraveaakkaissplle
    tsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtvi
    atgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wgjB (B:)
    ghmatlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrg
    lgaganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgalt
    vgvvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadn
    vlrqgvqgisdliatpglinldfadvktimsnqgsalmgigvssgenraveaakkaissp
    lletsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivv
    tviatgfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wgjB (B:)
    atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
    ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
    vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
    qgvqgisdliatpglinldfadvktimsnqgsalmgigvssgenraveaakkaissplle
    tsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtvi
    atgf