SCOPe 2.05: Structural Classification of Proteins

PDB entry 3wgd

View 3wgd on RCSB PDB site
Description: Crystal structure of ERp46 Trx1
Class: isomerase
Keywords: PDI family member, thioredoxin domain, protein disulfide isomerase, ISOMERASE
Deposited on 2013-08-04, released 2014-06-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.19
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Thioredoxin domain-containing protein 5
Species: Homo sapiens [TaxId:9606]
Gene: TXNDC5
Database cross-references and differences (RAF-indexed):
- Uniprot Q8NBS9 (4-112)
  - expression tag (2-3)
Domains in SCOPe 2.05: d3wgda_
Chain 'B':
Compound: Thioredoxin domain-containing protein 5
Species: Homo sapiens [TaxId:9606]
Gene: TXNDC5
Database cross-references and differences (RAF-indexed):
- Uniprot Q8NBS9 (4-112)
  - expression tag (2-3)
Domains in SCOPe 2.05: d3wgdb_
Chain 'C':
Compound: Thioredoxin domain-containing protein 5
Species: Homo sapiens [TaxId:9606]
Gene: TXNDC5
Database cross-references and differences (RAF-indexed):
- Uniprot Q8NBS9 (4-112)
  - expression tag (1-3)
Domains in SCOPe 2.05: d3wgdc_
Chain 'D':
Compound: Thioredoxin domain-containing protein 5
Species: Homo sapiens [TaxId:9606]
Gene: TXNDC5
Database cross-references and differences (RAF-indexed):
- Uniprot Q8NBS9 (4-112)
  - expression tag (2-3)
Domains in SCOPe 2.05: d3wgdd_
Chain 'E':
Compound: Thioredoxin domain-containing protein 5
Species: Homo sapiens [TaxId:9606]
Gene: TXNDC5
Database cross-references and differences (RAF-indexed):
- Uniprot Q8NBS9 (4-112)
  - expression tag (2-3)
Domains in SCOPe 2.05: d3wgde_
Chain 'F':
Compound: Thioredoxin domain-containing protein 5
Species: Homo sapiens [TaxId:9606]
Gene: TXNDC5
Database cross-references and differences (RAF-indexed):
- Uniprot Q8NBS9 (4-112)
  - expression tag (2-3)
Domains in SCOPe 2.05: d3wgdf_
Chain 'G':
Compound: Thioredoxin domain-containing protein 5
Species: Homo sapiens [TaxId:9606]
Gene: TXNDC5
Database cross-references and differences (RAF-indexed):
- Uniprot Q8NBS9 (4-112)
  - expression tag (2-3)
Domains in SCOPe 2.05: d3wgdg_
Chain 'H':
Compound: Thioredoxin domain-containing protein 5
Species: Homo sapiens [TaxId:9606]
Gene: TXNDC5
Database cross-references and differences (RAF-indexed):
- Uniprot Q8NBS9 (4-112)
  - expression tag (3)
Domains in SCOPe 2.05: d3wgdh_
Chain 'I':
Compound: Thioredoxin domain-containing protein 5
Species: Homo sapiens [TaxId:9606]
Gene: TXNDC5
Database cross-references and differences (RAF-indexed):
- Uniprot Q8NBS9 (4-112)
  - expression tag (2-3)
Domains in SCOPe 2.05: d3wgdi_
Heterogens: PO4, GOL, K, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3wgdA (A:)
gshmskhlytadmfthgiqsaahfvmffapwcghcqrlqptwndlgdkynsmedakvyva
kvdctahsdvcsaqgvrgyptlklfkpgqeavkyqgprdfqtlenwmlqtlne