PDB entry 3wgc

View 3wgc on RCSB PDB site
Description: Aeromonas jandaei L-allo-threonine aldolase H128Y/S292R double mutant
Class: lyase
Keywords: LYASE, PYRIDOXAL-5'-PHOSPHATE, threonine aldolase
Deposited on 2013-08-03, released 2014-07-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-09, with a file datestamp of 2014-07-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.189
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-allo-threonine aldolase
    Species: Aeromonas jandaei [TaxId:650]
    Gene: LATA, ltaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07051
      • engineered mutation (130)
    Domains in SCOPe 2.07: d3wgca_
  • Chain 'B':
    Compound: L-allo-threonine aldolase
    Species: Aeromonas jandaei [TaxId:650]
    Gene: LATA, ltaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07051
      • engineered mutation (130)
      • engineered mutation (294)
    Domains in SCOPe 2.07: d3wgcb_
  • Chain 'C':
    Compound: L-allo-threonine aldolase
    Species: Aeromonas jandaei [TaxId:650]
    Gene: LATA, ltaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07051
      • engineered mutation (130)
      • engineered mutation (294)
    Domains in SCOPe 2.07: d3wgcc_
  • Chain 'D':
    Compound: L-allo-threonine aldolase
    Species: Aeromonas jandaei [TaxId:650]
    Gene: LATA, ltaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07051
      • engineered mutation (130)
      • engineered mutation (294)
    Domains in SCOPe 2.07: d3wgcd_
  • Heterogens: PLG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wgcA (A:)
    gshmryidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfv
    psgtmsnllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqadgslalad
    vraaiapddvyftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavv
    asghtvrelvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagila
    qaglfalqqhvvrladdhrrarqlaeglaalpgirldlaqvqtnmvflqltsgeraplla
    fmkargilfsgygelrlvthlqihdddieevidafteylga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wgcA (A:)
    ryidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfvpsgt
    msnllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqadgslaladvraa
    iapddvyftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavvasgh
    tvrelvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagilaqagl
    falqqhvvrladdhrrarqlaeglaallaqvqtnmvflqapllafmkargilfsgelrlv
    thlqihdddieevidafteyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wgcB (B:)
    gshmryidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfv
    psgtmsnllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqadgslalad
    vraaiapddvyftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavv
    asghtvrelvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagila
    qaglfalqqhvvrladdhrrarqlaeglaalpgirldlaqvqtnmvflqltsgeraplla
    fmkargilfsgygelrlvthlqihdddieevidafteylga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wgcB (B:)
    ryidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfvpsgt
    msnllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqadgslaladvraa
    iapddvyftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavvasgh
    tvrelvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagilaqagl
    falqqhvvrladdhrrarqlaeglaalpgirldlaqvqtnmvflqltsgerapllafmka
    rgilfsgelrlvthlqihdddieevidafteyl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wgcC (C:)
    gshmryidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfv
    psgtmsnllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqadgslalad
    vraaiapddvyftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavv
    asghtvrelvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagila
    qaglfalqqhvvrladdhrrarqlaeglaalpgirldlaqvqtnmvflqltsgeraplla
    fmkargilfsgygelrlvthlqihdddieevidafteylga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wgcC (C:)
    ryidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfvpsgt
    msnllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqadgslaladvraa
    iapddvyftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavvasgh
    tvrelvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagilaqagl
    falqqhvvrladdhrrarqlaeglagirldlaqvqtnmvflqlrapllafmkargilfse
    lrlvthlqihdddieevidafteyl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wgcD (D:)
    gshmryidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfv
    psgtmsnllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqadgslalad
    vraaiapddvyftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavv
    asghtvrelvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagila
    qaglfalqqhvvrladdhrrarqlaeglaalpgirldlaqvqtnmvflqltsgeraplla
    fmkargilfsgygelrlvthlqihdddieevidafteylga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wgcD (D:)
    ryidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfvpsgt
    msnllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqadgslaladvraa
    iapddvyftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavvasgh
    tvrelvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagilaqagl
    falqqhvvrladdhrrarqlaeglaalpgirldlaqvqtnmvflqlterapllafmkarg
    ilfsgelrlvthlqihdddieevidafteyl