PDB entry 3wgb

View 3wgb on RCSB PDB site
Description: Crystal structure of aeromonas jandaei L-allo-threonine aldolase
Class: lyase
Keywords: LYASE, PYRIDOXAL-5'-PHOSPHATE, threonine aldolase
Deposited on 2013-08-03, released 2014-07-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-09, with a file datestamp of 2014-07-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.235
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-allo-threonine aldolase
    Species: Aeromonas jandaei [TaxId:650]
    Gene: LATA, ltaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wgba_
  • Chain 'B':
    Compound: L-allo-threonine aldolase
    Species: Aeromonas jandaei [TaxId:650]
    Gene: LATA, ltaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wgbb_
  • Chain 'C':
    Compound: L-allo-threonine aldolase
    Species: Aeromonas jandaei [TaxId:650]
    Gene: LATA, ltaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wgbc_
  • Chain 'D':
    Compound: L-allo-threonine aldolase
    Species: Aeromonas jandaei [TaxId:650]
    Gene: LATA, ltaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wgbd_
  • Heterogens: PLG, GLY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wgbA (A:)
    gshmryidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfv
    psgtmsnllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqadgslalad
    vraaiapddvhftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavv
    asghtvrelvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagila
    qaglfalqqhvvrladdhrrarqlaeglaalpgirldlaqvqtnmvflqltsgesaplla
    fmkargilfsgygelrlvthlqihdddieevidafteylga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wgbA (A:)
    yidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfvpsgtm
    snllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqdgslaladvraaia
    ddvhftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavvasghtvr
    elvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagilaqaglfal
    qqhvvrladdhrrarqlaeglaalgirldlaqvqtnmvflqltsapllafmkargilfsl
    rlvthlqihdddieevidafteyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wgbB (B:)
    gshmryidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfv
    psgtmsnllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqadgslalad
    vraaiapddvhftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavv
    asghtvrelvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagila
    qaglfalqqhvvrladdhrrarqlaeglaalpgirldlaqvqtnmvflqltsgesaplla
    fmkargilfsgygelrlvthlqihdddieevidafteylga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wgbB (B:)
    yidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfvpsgtm
    snllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqdgslaladvraaia
    ddvhftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavvasghtvr
    elvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagilaqaglfal
    qqhvvrladdhrrarqlaeglaalrldlaqvqtnmvflqlpllafmkargilfsglrlvt
    hlqihdddieevidaftey
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wgbC (C:)
    gshmryidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfv
    psgtmsnllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqadgslalad
    vraaiapddvhftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavv
    asghtvrelvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagila
    qaglfalqqhvvrladdhrrarqlaeglaalpgirldlaqvqtnmvflqltsgesaplla
    fmkargilfsgygelrlvthlqihdddieevidafteylga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wgbC (C:)
    yidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfvpsgtm
    snllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqadgslaladvraai
    apddvhftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavvasght
    vrelvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagilaqaglf
    alqqhvvrladdhrrarqlaeglaalgirldlaqvqtnmvflqltesapllafmkargil
    fslrlvthlqihdddieevidafteyl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wgbD (D:)
    gshmryidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfv
    psgtmsnllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqadgslalad
    vraaiapddvhftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavv
    asghtvrelvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagila
    qaglfalqqhvvrladdhrrarqlaeglaalpgirldlaqvqtnmvflqltsgesaplla
    fmkargilfsgygelrlvthlqihdddieevidafteylga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wgbD (D:)
    yidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfvpsgtm
    snllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmdgslaladvraaiap
    ddvhftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavvasghtvr
    elvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagilaqaglfal
    qqhvvrladdhrrarqlaeglalpgirldlaqvqtnmvflqltsapllafmkargilfse
    lrlvthlqihdddievidafteyl