PDB entry 3wg4

View 3wg4 on RCSB PDB site
Description: Crystal structure of Agrocybe cylindracea galectin mutant (N46A) with blood type A antigen tetraose
Class: sugar binding protein
Keywords: galectin, galactose binding, SUGAR BINDING PROTEIN
Deposited on 2013-07-25, released 2013-11-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.149
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactoside-binding lectin
    Species: Agrocybe cylindracea [TaxId:64608]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WG4
    Domains in SCOPe 2.05: d3wg4a_
  • Chain 'B':
    Compound: Galactoside-binding lectin
    Species: Agrocybe cylindracea [TaxId:64608]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WG4
    Domains in SCOPe 2.05: d3wg4b_
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wg4A (A:)
    mdykddddkhmttsavniynisagasvdlaapvttgdivtffssalnlsagagspantal
    nllsengayllhiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdh
    gdkyqvvinektviqytkqisgttsslsynstegtsifstvveavtytglaklaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wg4A (A:)
    khmttsavniynisagasvdlaapvttgdivtffssalnlsgspantalnllsengayll
    hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
    tviqytkqisgttsslsynstgtsifstvveavtytgla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wg4B (B:)
    mdykddddkhmttsavniynisagasvdlaapvttgdivtffssalnlsagagspantal
    nllsengayllhiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdh
    gdkyqvvinektviqytkqisgttsslsynstegtsifstvveavtytglaklaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wg4B (B:)
    hmttsavniynisagasvdlaapvttgdivtffssalnlpantalnllsengayllhiaf
    rlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinektviq
    ytkqisgttsslsynsttsifstvveavtytgla