PDB entry 3wg2

View 3wg2 on RCSB PDB site
Description: Crystal structure of Agrocybe cylindracea galectin mutant (N46A)
Class: sugar binding protein
Keywords: galectin, galactose binding, SUGAR BINDING PROTEIN
Deposited on 2013-07-25, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactoside-binding lectin
    Species: Agrocybe aegerita [TaxId:5400]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WG2
    Domains in SCOPe 2.07: d3wg2a1, d3wg2a2
  • Chain 'B':
    Compound: Galactoside-binding lectin
    Species: Agrocybe aegerita [TaxId:5400]
    Database cross-references and differences (RAF-indexed):
    • PDB 3WG2
    Domains in SCOPe 2.07: d3wg2b1, d3wg2b2
  • Heterogens: PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wg2A (A:)
    mdykddddkhmttsavniynisagasvdlaapvttgdivtffssalnlsagagspantal
    nllsengayllhiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdh
    gdkyqvvinektviqytkqisgttsslsynstegtsifstvveavtytglaklaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wg2A (A:)
    tsavniynisagasvdlaapvttgdivtffssalnlsntalnllsengayllhiafrlqe
    nvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinektviqytkq
    isgttsslsynstegtsifstvveavtytgla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wg2B (B:)
    mdykddddkhmttsavniynisagasvdlaapvttgdivtffssalnlsagagspantal
    nllsengayllhiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdh
    gdkyqvvinektviqytkqisgttsslsynstegtsifstvveavtytglaklaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wg2B (B:)
    tsavniynisagasvdlaapvttgdivtffssalnlsntalnllsengayllhiafrlqe
    nvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinektviqytkq
    isgttsslsynstegtsifstvveavtytgla