PDB entry 3weo

View 3weo on RCSB PDB site
Description: Sugar beet alpha-glucosidase with acarviosyl-maltohexaose
Class: hydrolase
Keywords: alpha-glucosidase, glycoside hydrolase family 31, (beta/alpha)8-barrel, acarbose derivative, HYDROLASE
Deposited on 2013-07-09, released 2014-07-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.124
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3weoA (A:)
    mersklpryicatlavvlplvlcmvvegattskndnqgeaigygyqvknakvdnstgksl
    tallqlirnspvygpdiqflsftasfeeddtlriritdannrrweipnevlprpppppsp
    pplsslqhlpkpipqnqptttvlshphsdlvftlfhttpfgftiyrksthdvlfdatpip
    snpttfliykdqylqlssslpaqqahlyglgehtkptfqlahnqiltlwnadiasfnrdl
    nlygshpfymdvrsspmvgsthgvfllnsngmdveytgdritykviggiidlyifagrtp
    emvldqytkligrpapmpywafgfhqcrwgyrdvneietvvdkyaeariplevmwtdidy
    mdafkdftldpvhfpldkmqqfvtklhrngqryvpildpgintnksygtfirgmqsnvfi
    krdgnpylgsvwpgpvyypdfldpaarsfwvdeikrfrdilpidgiwidmneasnfitsa
    ptpgstldnppykinnsggrvpinsktipatamhygnvteynahnlygflesqatrealv
    rtsnerpfllsrstfagsgkytahwtgdnaarwddlqysiptmlnfglfgmpmigadicg
    faestteelcrrwiqlgafypfsrdhsardtthqelylwesvaasartvlglryqllpyy
    ytlmydanlrgipiarplfftfpddvatygissqfligrgimvspvlqpgavsvnayfpr
    gnwfslfnytssvsvsagtyvslsappdhinvhihegnivamqgeamttqaarstpfhll
    vvmsdhvastgelfldngiemdiggpggkwtlvrffaesginnltissevvnrgyamsqr
    wvmdkitilglkrrvrikeytvqkdagaikikglglrtsshnqggfvvsvisdlrqlvgq
    afklelefegatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3weoA (A:)
    geaigygyqvknakvdnstgksltallqlirnspvygpdiqflsftasfeeddtlririt
    dannrrweipnevlprpppppptttvlshphsdlvftlfhttpfgftiyrksthdvlfda
    tpipsnpttfliykdqylqlssslpaqqahlyglgehtkptfqlahnqiltlwnadiasf
    nrdlnlygshpfymdvrsspmvgsthgvfllnsngmdveytgdritykviggiidlyifa
    grtpemvldqytkligrpapmpywafgfhqcrwgyrdvneietvvdkyaeariplevmwt
    didymdafkdftldpvhfpldkmqqfvtklhrngqryvpildpgintnksygtfirgmqs
    nvfikrdgnpylgsvwpgpvyypdfldpaarsfwvdeikrfrdilpidgiwidmneasnf
    itsaptpgstldnppykinnsggrvpinsktipatamhygnvteynahnlygflesqatr
    ealvrtsnerpfllsrstfagsgkytahwtgdnaarwddlqysiptmlnfglfgmpmiga
    dicgfaestteelcrrwiqlgafypfsrdhsardtthqelylwesvaasartvlglryql
    lpyyytlmydanlrgipiarplfftfpddvatygissqfligrgimvspvlqpgavsvna
    yfprgnwfslfnytssvsvsagtyvslsappdhinvhihegnivamqgeamttqaarstp
    fhllvvmsdhvastgelfldngiemdiggpggkwtlvrffaesginnltissevvnrgya
    msqrwvmdkitilglkrrvrikgfvvsvisdlrqlvgqafklelefe