PDB entry 3wek

View 3wek on RCSB PDB site
Description: Crystal structure of the human squalene synthase F288L mutant in complex with presqualene pyrophosphate
Class: transferase
Keywords: Farnesyl-diphosphate farnesyltransferase, Head-to-head synthases, Cholesterol biosynthesis, Oxidoreductase, Transferase
Deposited on 2013-07-07, released 2014-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.227
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Squalene synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: FDFT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37268
      • engineered mutation (260)
    Domains in SCOPe 2.07: d3weka_
  • Heterogens: MG, PS7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wekA (A:)
    gshmdqdslssslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmt
    isvekkvpllhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadic
    rrmgigmaefldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransm
    glflqktniirdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnal
    hhipdvitylsrlrnqsvfnlcaipqvmaiatlaacynnqqvfkgavkirkgqavtlmmd
    atnmpavkaiiyqymeeiyhripdsdpsssktrqiistirtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wekA (A:)
    slssslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkv
    pllhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigm
    aefldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqkt
    niirdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdvi
    tylsrlrnqsvfnlcaipqvmaiatlaacynnqqvfkgavkirkgqavtlmmdatnmpav
    kaiiyqymeeiyhripdsdpsssktrqiistirtq