PDB entry 3wec

View 3wec on RCSB PDB site
Description: Structure of P450 RauA (CYP1050A1) complexed with a biosynthetic intermediate of aurachin RE
Class: oxidoreductase
Keywords: P450 fold, monooxygenase (hydroxylase), heme, Cytosolic enzyme, OXIDOREDUCTASE
Deposited on 2013-07-03, released 2014-01-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.216
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: rauA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3weca_
  • Heterogens: HEM, AUI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wecA (A:)
    mthtvddtgdlalavnpfdptfkadpypvyarlrtelpihrsalgawivadytscdkvlr
    srlfgkdfanstffdhltsmmgedmppflglgidgdarpfmltdppehtrlrglvsdaft
    rstttsmddivlsaassavrhlehctdavsevaepfpvevlssilgipdkdrgrfsewsn
    lvagvldinfaipkevadrrsaaieesidyfrtlatsgnapeglvrrlsevshggdqlsv
    deiaatcllitvagqettsntignmlitfsrhadqfeqvranpqfienavaevlrfeppa
    heagrialedcevsganitkgdavmvllasgnreavergdtfsvtrpdvsslsygrgihh
    clgsalansmlqhflrelsqryrsievaepinykpgmglrgpetlsvavsrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wecA (A:)
    lalavnpfdptfkadpypvyarlrtelpihrsalgawivadytscdkvlrsrlfgkdfan
    stffdhltsmmgedmppflglgidgdarpfmltdppehtrlrglvsdaftrstttsmddi
    vlsaassavrhlehctdavsevaepfpvevlssilgipdkdrgrfsewsnlvagvldinf
    aipkevadrrsaaieesidyfrtlatsgnapeglvrrlsevshggdqlsvdeiaatclli
    tvagqettsntignmlitfsrhadqfeqvranpqfienavaevlrfeppaheagrialed
    cevsganitkgdavmvllasgnreavergdtfsvtrpdvsslsygrgihhclgsalansm
    lqhflrelsqryrsievaepinykpgmglrgpetlsvavsr