PDB entry 3wds

View 3wds on RCSB PDB site
Description: Crystal structure of 3-quinuclidinone reductase from Agrobacterium tumefaciens
Class: oxidoreductase
Keywords: SDR, 3-quinuclidinone, Rossmann Fold, Carbonyl Reductase, NAD, OXIDOREDUCTASE
Deposited on 2013-06-22, released 2014-06-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.151
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADH-dependent quinuclidinone reductase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WDS (Start-262)
    Domains in SCOPe 2.05: d3wdsa_
  • Chain 'B':
    Compound: NADH-dependent quinuclidinone reductase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WDS (Start-262)
    Domains in SCOPe 2.05: d3wdsb_
  • Chain 'C':
    Compound: NADH-dependent quinuclidinone reductase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WDS (Start-262)
    Domains in SCOPe 2.05: d3wdsc_
  • Chain 'D':
    Compound: NADH-dependent quinuclidinone reductase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WDS (Start-262)
    Domains in SCOPe 2.05: d3wdsd_
  • Heterogens: NAD, ACY, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wdsA (A:)
    gshmagifdlsgrkaivtggskgigaaiaraldkagatvaiadldvmaaqavvaglengg
    favevdvtkrasvdaamqkaidalggfdllcanagvstmrpavditdeewdfnfdvnarg
    vflanqiacrhflasntkgvivntaslaakvgapllahysaskfavfgwtqalaremapk
    nirvncvcpgfvktamqereiiweaelrgmtpeavraeyvsltplgrieepedvadvvvf
    lasdaarfmtgqginvtggvrmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wdsA (A:)
    ifdlsgrkaivtggskgigaaiaraldkagatvaiadldvmaaqavvaglenggfavevd
    vtkrasvdaamqkaidalggfdllcanagvstmrpavditdeewdfnfdvnargvflanq
    iacrhflasntkgvivntaslaakvgapllahysaskfavfgwtqalaremapknirvnc
    vcpgfvktamqereiiweaelrgmtpeavraeyvsltplgrieepedvadvvvflasdaa
    rfmtgqginvtggvrmd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wdsB (B:)
    gshmagifdlsgrkaivtggskgigaaiaraldkagatvaiadldvmaaqavvaglengg
    favevdvtkrasvdaamqkaidalggfdllcanagvstmrpavditdeewdfnfdvnarg
    vflanqiacrhflasntkgvivntaslaakvgapllahysaskfavfgwtqalaremapk
    nirvncvcpgfvktamqereiiweaelrgmtpeavraeyvsltplgrieepedvadvvvf
    lasdaarfmtgqginvtggvrmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wdsB (B:)
    ifdlsgrkaivtggskgigaaiaraldkagatvaiadldvmaaqavvaglenggfavevd
    vtkrasvdaamqkaidalggfdllcanagvstmrpavditdeewdfnfdvnargvflanq
    iacrhflasntkgvivntaslaakvgapllahysaskfavfgwtqalaremapknirvnc
    vcpgfvktamqereiiweaelrgmtpeavraeyvsltplgrieepedvadvvvflasdaa
    rfmtgqginvtggvrmd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wdsC (C:)
    gshmagifdlsgrkaivtggskgigaaiaraldkagatvaiadldvmaaqavvaglengg
    favevdvtkrasvdaamqkaidalggfdllcanagvstmrpavditdeewdfnfdvnarg
    vflanqiacrhflasntkgvivntaslaakvgapllahysaskfavfgwtqalaremapk
    nirvncvcpgfvktamqereiiweaelrgmtpeavraeyvsltplgrieepedvadvvvf
    lasdaarfmtgqginvtggvrmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wdsC (C:)
    ifdlsgrkaivtggskgigaaiaraldkagatvaiadldvmaaqavvaglenggfavevd
    vtkrasvdaamqkaidalggfdllcanagvstmrpavditdeewdfnfdvnargvflanq
    iacrhflasntkgvivntaslaakvgapllahysaskfavfgwtqalaremapknirvnc
    vcpgfvktamqereiiweaelrgmtpeavraeyvsltplgrieepedvadvvvflasdaa
    rfmtgqginvtggvrmd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wdsD (D:)
    gshmagifdlsgrkaivtggskgigaaiaraldkagatvaiadldvmaaqavvaglengg
    favevdvtkrasvdaamqkaidalggfdllcanagvstmrpavditdeewdfnfdvnarg
    vflanqiacrhflasntkgvivntaslaakvgapllahysaskfavfgwtqalaremapk
    nirvncvcpgfvktamqereiiweaelrgmtpeavraeyvsltplgrieepedvadvvvf
    lasdaarfmtgqginvtggvrmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wdsD (D:)
    ifdlsgrkaivtggskgigaaiaraldkagatvaiadldvmaaqavvaglenggfavevd
    vtkrasvdaamqkaidalggfdllcanagvstmrpavditdeewdfnfdvnargvflanq
    iacrhflasntkgvivntaslaakvgapllahysaskfavfgwtqalaremapknirvnc
    vcpgfvktamqereiiweaelrgmtpeavraeyvsltplgrieepedvadvvvflasdaa
    rfmtgqginvtggvrmd