PDB entry 3wdn

View 3wdn on RCSB PDB site
Description: High-resolution X-ray crystal structure of bovine H-protein using a high-pressure cryocooling method
Class: oxidoreductase
Keywords: antiparallel beta sheet, beta sandwich, OXIDOREDUCTASE
Deposited on 2013-06-19, released 2013-10-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 0.86 Å
R-factor: 0.114
AEROSPACI score: 1.12 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Glycine cleavage system H protein, mitochondrial
  Species: Bos taurus [TaxId:9913]
  Gene: Gcsh
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20821 (0-124)
  Domains in SCOPe 2.08: d3wdna_
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3wdnA (A:)
  svrkftekhewvttengvgtvgisnfaqealgdvvycslpevgtklnkqeefgalesvka
  aselysplsgevteinkalaenpglvnkscyedgwlikmtfsnpseldelmseeayekyi
  ksiee