PDB entry 3wd6

View 3wd6 on RCSB PDB site
Description: Crystal structure of Bombyx mori omega-class glutathione transferase in complex with GSH
Class: transferase
Keywords: electron sharing network, TRANSFERASE, glutathione binding
Deposited on 2013-06-07, released 2014-07-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Omega-class glutathione S-transferase
    Species: Bombyx mori [TaxId:7091]
    Gene: gsto, GSTo2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3wd6a1, d3wd6a2
  • Chain 'B':
    Compound: Omega-class glutathione S-transferase
    Species: Bombyx mori [TaxId:7091]
    Gene: gsto, GSTo2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3wd6b1, d3wd6b2
  • Chain 'C':
    Compound: Omega-class glutathione S-transferase
    Species: Bombyx mori [TaxId:7091]
    Gene: gsto, GSTo2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3wd6c1, d3wd6c2
  • Chain 'D':
    Compound: Omega-class glutathione S-transferase
    Species: Bombyx mori [TaxId:7091]
    Gene: gsto, GSTo2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3wd6d1, d3wd6d2
  • Heterogens: K, EDO, PEG, GSH, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wd6A (A:)
    msaikdsrninfntkhlrkgdplppfngklrvynmrycpyaqrtilalnakqidyevvni
    dlidkpewlttksafakvpaieiaedvtiyeslvtveyldevypkrpllpqdplkkaldk
    iiveasapiqslfikilkfsdtvneehvaayhkaldfiqeqlknrgtvfldgsepgyady
    miwpwferlrafahdervrlepskysllleyidnmlkdsavsqylipleilakfheaytk
    kerpnyellneclksf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wd6A (A:)
    ninfntkhlrkgdplppfngklrvynmrycpyaqrtilalnakqidyevvnidlidkpew
    lttksafakvpaieiaedvtiyeslvtveyldevypkrpllpqdplkkaldkiiveasap
    iqslfikilkfsdtvneehvaayhkaldfiqeqlknrgtvfldgsepgyadymiwpwfer
    lrafahdervrlepskysllleyidnmlkdsavsqylipleilakfheaytkkerpnyel
    ln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wd6B (B:)
    msaikdsrninfntkhlrkgdplppfngklrvynmrycpyaqrtilalnakqidyevvni
    dlidkpewlttksafakvpaieiaedvtiyeslvtveyldevypkrpllpqdplkkaldk
    iiveasapiqslfikilkfsdtvneehvaayhkaldfiqeqlknrgtvfldgsepgyady
    miwpwferlrafahdervrlepskysllleyidnmlkdsavsqylipleilakfheaytk
    kerpnyellneclksf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wd6B (B:)
    infntkhlrkgdplppfngklrvynmrycpyaqrtilalnakqidyevvnidlidkpewl
    ttksafakvpaieiaedvtiyeslvtveyldevypkrpllpqdplkkaldkiiveasapi
    qslfikilkfsdtvneehvaayhkaldfiqeqlknrgtvfldgsepgyadymiwpwferl
    rafahdervrlepskysllleyidnmlkdsavsqylipleilakfheaytkkerpnyell
    n
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wd6C (C:)
    msaikdsrninfntkhlrkgdplppfngklrvynmrycpyaqrtilalnakqidyevvni
    dlidkpewlttksafakvpaieiaedvtiyeslvtveyldevypkrpllpqdplkkaldk
    iiveasapiqslfikilkfsdtvneehvaayhkaldfiqeqlknrgtvfldgsepgyady
    miwpwferlrafahdervrlepskysllleyidnmlkdsavsqylipleilakfheaytk
    kerpnyellneclksf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wd6C (C:)
    infntkhlrkgdplppfngklrvynmrycpyaqrtilalnakqidyevvnidlidkpewl
    ttksafakvpaieiaedvtiyeslvtveyldevypkrpllpqdplkkaldkiiveasapi
    qslfikilkfsdtvneehvaayhkaldfiqeqlknrgtvfldgsepgyadymiwpwferl
    rafahdervrlepskysllleyidnmlkdsavsqylipleilakfheaytkkerpnyell
    n
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wd6D (D:)
    msaikdsrninfntkhlrkgdplppfngklrvynmrycpyaqrtilalnakqidyevvni
    dlidkpewlttksafakvpaieiaedvtiyeslvtveyldevypkrpllpqdplkkaldk
    iiveasapiqslfikilkfsdtvneehvaayhkaldfiqeqlknrgtvfldgsepgyady
    miwpwferlrafahdervrlepskysllleyidnmlkdsavsqylipleilakfheaytk
    kerpnyellneclksf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wd6D (D:)
    ninfntkhlrkgdplppfngklrvynmrycpyaqrtilalnakqidyevvnidlidkpew
    lttksafakvpaieiaedvtiyeslvtveyldevypkrpllpqdplkkaldkiiveasap
    iqslfikilkfsdtvneehvaayhkaldfiqeqlknrgtvfldgsepgyadymiwpwfer
    lrafahdervrlepskysllleyidnmlkdsavsqylipleilakfheaytkkerpnyel
    ln