PDB entry 3wcw

View 3wcw on RCSB PDB site
Description: The structure of a deoxygenated 400 kda hemoglobin provides a more accurate description of the cooperative mechanism of giant hemoglobins: MG bound form
Class: Oxygen Transport
Keywords: globin fold, oxygen transport, oxygen binding, blood
Deposited on 2013-06-01, released 2014-06-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.207
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A1 globin chain of giant V2 hemoglobin
    Species: Lamellibrachia satsuma [TaxId:104711]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wcwa_
  • Chain 'B':
    Compound: A2 globin chain of giant V2 hemoglobin
    Species: Lamellibrachia satsuma [TaxId:104711]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wcwb_
  • Chain 'C':
    Compound: B2 globin chain of giant V2 hemoglobin
    Species: Lamellibrachia satsuma [TaxId:104711]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wcwc_
  • Chain 'D':
    Compound: B1 globin chain of giant V2 hemoglobin
    Species: Lamellibrachia satsuma [TaxId:104711]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wcwd_
  • Chain 'E':
    Compound: A1 globin chain of giant V2 hemoglobin
    Species: Lamellibrachia satsuma [TaxId:104711]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wcwe_
  • Chain 'F':
    Compound: A2 globin chain of giant V2 hemoglobin
    Species: Lamellibrachia satsuma [TaxId:104711]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wcwf_
  • Chain 'G':
    Compound: B2 globin chain of giant V2 hemoglobin
    Species: Lamellibrachia satsuma [TaxId:104711]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wcwg_
  • Chain 'H':
    Compound: B1 globin chain of giant V2 hemoglobin
    Species: Lamellibrachia satsuma [TaxId:104711]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wcwh_
  • Heterogens: HEM, OXY, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wcwA (A:)
    dcnilqrlkvkmqwakaygfgterakfgnslwtsifnyapdardlfksvksedmrspqfk
    ahiarviggldrvismfdnedalnadlehlksqhdprgldalnfvvfgkalfatvggqfg
    vcfdlpawescykviamgitgndmfs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wcwB (B:)
    secgplqrlkvkrqwaeaygsgngreefghfiwanvfkvapsardmfkrvrgdniytpaf
    rahatrvlggldmcvallddesvlntqlahlasqhssrgvsaeqynvvehavmmgvehei
    gqnvfdkdawqacldvitsgiqgn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wcwC (C:)
    ssnscttedrremqlmwanvwsaqftgrrlaiaqavfkdlfahvpdavglfdrvhgteid
    ssefkahcirvvngldsaigllsdpstlneqlshlatqhqeragvtkggfsaiaqsflrv
    mpqvascfnpdawsrcfnritngmteglae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wcwD (D:)
    sefcseadativikqwnqiynagigaksrwtmgneifsslfklkpesevlfnnvnvanms
    sgafhahtvrvlsgldmginylndagtltsltahlaaqhvartglkavyfdamgkvlmtv
    lpslidnfnpdawrncllplknaiakglp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wcwD (D:)
    fcseadativikqwnqiynagigaksrwtmgneifsslfklkpesevlfnnvnvanmssg
    afhahtvrvlsgldmginylndagtltsltahlaaqhvartglkavyfdamgkvlmtvlp
    slidnfnpdawrncllplknaiakglp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wcwE (E:)
    dcnilqrlkvkmqwakaygfgterakfgnslwtsifnyapdardlfksvksedmrspqfk
    ahiarviggldrvismfdnedalnadlehlksqhdprgldalnfvvfgkalfatvggqfg
    vcfdlpawescykviamgitgndmfs
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wcwF (F:)
    secgplqrlkvkrqwaeaygsgngreefghfiwanvfkvapsardmfkrvrgdniytpaf
    rahatrvlggldmcvallddesvlntqlahlasqhssrgvsaeqynvvehavmmgvehei
    gqnvfdkdawqacldvitsgiqgn
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wcwG (G:)
    ssnscttedrremqlmwanvwsaqftgrrlaiaqavfkdlfahvpdavglfdrvhgteid
    ssefkahcirvvngldsaigllsdpstlneqlshlatqhqeragvtkggfsaiaqsflrv
    mpqvascfnpdawsrcfnritngmteglae
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3wcwH (H:)
    sefcseadativikqwnqiynagigaksrwtmgneifsslfklkpesevlfnnvnvanms
    sgafhahtvrvlsgldmginylndagtltsltahlaaqhvartglkavyfdamgkvlmtv
    lpslidnfnpdawrncllplknaiakglp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wcwH (H:)
    fcseadativikqwnqiynagigaksrwtmgneifsslfklkpesevlfnnvnvanmssg
    afhahtvrvlsgldmginylndagtltsltahlaaqhvartglkavyfdamgkvlmtvlp
    slidnfnpdawrncllplknaiakglp