PDB entry 3wc3

View 3wc3 on RCSB PDB site
Description: Crystal structure of endo-1,4-beta-glucanase from Eisenia fetida
Class: hydrolase
Keywords: (alpha/alpha)6 barrel fold, Hydrolase, Sugar Binding
Deposited on 2013-05-24, released 2013-10-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.148
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1, 4-beta-glucanase
    Species: Eisenia fetida [TaxId:6396]
    Gene: EF-EG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot I2FI81 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.04: d3wc3a_
  • Heterogens: CA, NA, TRS, FLC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wc3A (A:)
    eaefqynydevleksilfyeaersgdlpannripyrgdsalgdqgnqgqdltggwydagd
    hvkfgfpmafatttlawgilefrdgyeaagqynlaldsirwtlnyflkahvsdnefygqv
    gdantdhaywgrpedmtmerpawsispsapgsdlaaetaaalaagylvfrdsdaafannl
    lahsrtlydfalnnrgiysqsisnaagfyassayedelawgaawlyrateeqeyldraye
    fgtttntawaydwnekivgyqlllttsagqtdflprvenflrnwfpggsvqytplglawl
    aqwgpnryaanaafialvsakynilaseseqfarsqihymlgdagrsyvvgfgnnppqqp
    hhrssscpdqpaecdwdefnqpgpnyqilygalvggpdqndqfedlrsdyirnevandyn
    agfqgavaalraiqlrdgkeqkliseedlnsavdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wc3A (A:)
    fqynydevleksilfyeaersgdlpannripyrgdsalgdqgnqgqdltggwydagdhvk
    fgfpmafatttlawgilefrdgyeaagqynlaldsirwtlnyflkahvsdnefygqvgda
    ntdhaywgrpedmtmerpawsispsapgsdlaaetaaalaagylvfrdsdaafannllah
    srtlydfalnnrgiysqsisnaagfyassayedelawgaawlyrateeqeyldrayefgt
    ttntawaydwnekivgyqlllttsagqtdflprvenflrnwfpggsvqytplglawlaqw
    gpnryaanaafialvsakynilaseseqfarsqihymlgdagrsyvvgfgnnppqqphhr
    ssscpdqpaecdwdefnqpgpnyqilygalvggpdqndqfedlrsdyirnevandynagf
    qgavaalraiqlrdg