PDB entry 3wbm

View 3wbm on RCSB PDB site
Description: Crystal Structure of protein-RNA complex
Class: RNA binding protein/RNA
Keywords: PROTEIN-RNA COMPLEX, DNA/RNA BINDING, RNA BINDING PROTEIN-RNA complex
Deposited on 2013-05-20, released 2013-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA/RNA-binding protein alba 1
    Species: Sulfolobus shibatae [TaxId:2286]
    Gene: albA1, ssh10b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wbma_
  • Chain 'B':
    Compound: DNA/RNA-binding protein alba 1
    Species: Sulfolobus shibatae [TaxId:2286]
    Gene: albA1, ssh10b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wbmb_
  • Chain 'C':
    Compound: DNA/RNA-binding protein alba 1
    Species: Sulfolobus shibatae [TaxId:2286]
    Gene: albA1, ssh10b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wbmc_
  • Chain 'D':
    Compound: DNA/RNA-binding protein alba 1
    Species: Sulfolobus shibatae [TaxId:2286]
    Gene: albA1, ssh10b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wbmd_
  • Chain 'X':
    Compound: RNA (25-mer)
  • Chain 'Y':
    Compound: RNA (25-mer)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wbmA (A:)
    mssgtptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrf
    lpdkieikeirvgsqvvtsqdgrqsrvstieiairkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbmA (A:)
    tptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdk
    ieikeirvgsqvvsrvstieiairkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wbmB (B:)
    mssgtptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrf
    lpdkieikeirvgsqvvtsqdgrqsrvstieiairkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbmB (B:)
    tpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdkie
    ikeirvgsqvvsrvstieiairkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wbmC (C:)
    mssgtptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrf
    lpdkieikeirvgsqvvtsqdgrqsrvstieiairkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbmC (C:)
    tptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdk
    ieikeirvgsqvvsrvstieiairkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wbmD (D:)
    mssgtptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrf
    lpdkieikeirvgsqvvtsqdgrqsrvstieiairkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wbmD (D:)
    snvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdkieik
    eirvgsqvvtsqdgrqsrvstieiairkk
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.