PDB entry 3wao

View 3wao on RCSB PDB site
Description: Crystal structure of Atg13 LIR-fused human LC3B_2-119
Class: apoptosis
Keywords: ubiquitin-like fold, autophagy, apoptosis
Deposited on 2013-05-06, released 2013-12-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Autophagy-related protein 13, Microtubule-associated proteins 1A/1B light chain 3B
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP1LC3B, MAP1ALC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75143 (Start-13)
      • linker (14-15)
    • Uniprot Q9GZQ8 (16-133)
    Domains in SCOPe 2.08: d3waoa_
  • Chain 'B':
    Compound: Autophagy-related protein 13, Microtubule-associated proteins 1A/1B light chain 3B
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP1LC3B, MAP1ALC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75143 (Start-13)
      • linker (14-15)
    • Uniprot Q9GZQ8 (16-End)
    Domains in SCOPe 2.08: d3waob_
  • Chain 'C':
    Compound: Autophagy-related protein 13, Microtubule-associated proteins 1A/1B light chain 3B
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP1LC3B, MAP1ALC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75143 (Start-13)
      • linker (14-15)
    • Uniprot Q9GZQ8 (16-End)
    Domains in SCOPe 2.08: d3waoc_
  • Chain 'D':
    Compound: Autophagy-related protein 13, Microtubule-associated proteins 1A/1B light chain 3B
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP1LC3B, MAP1ALC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75143 (Start-13)
      • linker (14-15)
    • Uniprot Q9GZQ8 (16-End)
    Domains in SCOPe 2.08: d3waod_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3waoA (A:)
    gsssgnthddfvmigspsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlp
    vldktkflvpdhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyesekde
    dgflymvyasqetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3waoA (A:)
    ddfvmigspsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkfl
    vpdhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvy
    asqetf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3waoB (B:)
    gsssgnthddfvmigspsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlp
    vldktkflvpdhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyesekde
    dgflymvyasqetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3waoB (B:)
    ddfvmigspsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkfl
    vpdhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvy
    asqe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3waoC (C:)
    gsssgnthddfvmigspsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlp
    vldktkflvpdhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyesekde
    dgflymvyasqetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3waoC (C:)
    ddfvmigspsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkfl
    vpdhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvy
    asqe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3waoD (D:)
    gsssgnthddfvmigspsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlp
    vldktkflvpdhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyesekde
    dgflymvyasqetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3waoD (D:)
    dfvmigspsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkflv
    pdhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvya
    sqet