PDB entry 3wa9

View 3wa9 on RCSB PDB site
Description: The nucleosome containing human H2A.Z.1
Class: structural protein/DNA
Keywords: histone fold, DNA binding, nucleus, chromatin formation, STRUCTURAL PROTEIN-DNA complex
Deposited on 2013-04-30, released 2013-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 3.07 Å
R-factor: 0.225
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.1
    Species: Homo sapiens [TaxId:9606]
    Gene: H3.1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Gene: H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wa9b_
  • Chain 'C':
    Compound: histone h2a.z
    Species: Homo sapiens [TaxId:9606]
    Gene: H2A.Z.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wa9c_
  • Chain 'D':
    Compound: Histone H2B type 1-J
    Species: Homo sapiens [TaxId:9606]
    Gene: H2B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wa9d_
  • Chain 'E':
    Compound: Histone H3.1
    Species: Homo sapiens [TaxId:9606]
    Gene: H3.1
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Gene: H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wa9f_
  • Chain 'G':
    Compound: histone h2a.z
    Species: Homo sapiens [TaxId:9606]
    Gene: H2A.Z.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wa9g_
  • Chain 'H':
    Compound: Histone H2B type 1-J
    Species: Homo sapiens [TaxId:9606]
    Gene: H2B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wa9h_
  • Chain 'I':
    Compound: DNA (146-mer)
  • Chain 'J':
    Compound: DNA (146-mer)

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wa9B (B:)
    gshmsgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrg
    vlkvflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wa9B (B:)
    niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
    dvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3wa9C (C:)
    gshmaggkagkdsgkaktkavsrsqraglqfpvgrihrhlksrttshgrvgataavysaa
    ileyltaevlelagnaskdlkvkritprhlqlairgdeeldslikatiagggviphihks
    ligkkgqqktv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wa9C (C:)
    kavsrsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnask
    dlkvkritprhlqlairgdeeldslikatiagggviphihksligk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3wa9D (D:)
    gshmpepaksapapkkgskkavtkaqkkdgkkrkrsrkesysiyvykvlkqvhpdtgiss
    kamgimnsfvndiferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtk
    avtkytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wa9D (D:)
    srkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstits
    reiqtavrlllpgelakhavsegtkavtkytsa
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3wa9F (F:)
    gshmsgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrg
    vlkvflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wa9F (F:)
    rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
    ktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3wa9G (G:)
    gshmaggkagkdsgkaktkavsrsqraglqfpvgrihrhlksrttshgrvgataavysaa
    ileyltaevlelagnaskdlkvkritprhlqlairgdeeldslikatiagggviphihks
    ligkkgqqktv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wa9G (G:)
    vsrsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnaskdl
    kvkritprhlqlairgdeeldslikatiagggviphihksligk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3wa9H (H:)
    gshmpepaksapapkkgskkavtkaqkkdgkkrkrsrkesysiyvykvlkqvhpdtgiss
    kamgimnsfvndiferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtk
    avtkytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wa9H (H:)
    srkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstits
    reiqtavrlllpgelakhavsegtkavtkytsa
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.