PDB entry 3w9c

View 3w9c on RCSB PDB site
Description: Crystal structure of the electron transfer complex of cytochrome p450cam with putidaredoxin
Class: oxidoreductase/electron transport
Keywords: inter-protein electron transfer, OXIDOREDUCTASE-ELECTRON TRANSPORT complex
Deposited on 2013-04-03, released 2013-08-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-415)
      • engineered mutation (127)
      • engineered mutation (131)
      • engineered mutation (335)
    Domains in SCOPe 2.06: d3w9ca_
  • Chain 'B':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (2-107)
      • engineered mutation (74)
    Domains in SCOPe 2.06: d3w9cb_
  • Heterogens: HEM, SO4, GOL, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w9cA (A:)
    mgttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrc
    ngghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqv
    vgmpvvdclenciqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlk
    yltdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdea
    krmcglllvggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadg
    riltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlcl
    gqhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w9cA (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreydfiptsmdppeqrqfralanqvvgmpvvdclenciqe
    lacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsmtf
    aeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldtv
    vnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhgvqlk
    kgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiivtlke
    wltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3w9cB (B:)
    mgskvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftd
    kvpaanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w9cB (B:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw