PDB entry 3w95

View 3w95 on RCSB PDB site
Description: Crystal structure of 2A proteinase (C110A) from enterovirus 71
Class: hydrolase
Keywords: chymotrypsin-fold six-stranded beta-barrel catalytic triad Zinc-coordination, chymotrypsin-fold six-stranded beta-barrel catalytic triad, Hydrolase
Deposited on 2013-03-27, released 2013-09-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.219
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: Human enterovirus 71 [TaxId:103922]
    Database cross-references and differences (RAF-indexed):
    • PDB 3W95
    Domains in SCOPe 2.05: d3w95a_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3w95A (A:)
mgsshhhhhhssglvprgshmgkfgqqsgaiyvgnfrvvnrhlathndwanlvwedssrd
llvssttaqgcdtiarcncqtgvyycnsrrkhypvsfskpsliyveaseyyparyqshlm
laqghsepgdaggilrcqhgvvgivstggnglvgfadvrdllwldeeameq

    Sequence, based on observed residues (ATOM records): (download) 
    >3w95A (A:)
shmgkfgqqsgaiyvgnfrvvnrhlathndwanlvwedssrdllvssttaqgcdtiarcn
cqtgvyycnsrrkhypvsfskpsliyveaseyyparyqshlmlaqghsepgdaggilrcq
hgvvgivstggnglvgfadvrdllwldee