PDB entry 3w8q

View 3w8q on RCSB PDB site
Description: Structure of the Human Mitogen-Activated Protein Kinase Kinase 1 (MEK1)
Class: transferase
Keywords: TRANSFERASE, Nucleotide-binding, Phosphorylation
Deposited on 2013-03-20, released 2014-03-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity mitogen-activated protein kinase kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP2K1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3w8qa_
  • Heterogens: AGS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w8qA (A:)
    eleldeqqrkrleafltqkqkvgelkdddfekiselgagnggvvfkvshkpsglvmarkl
    ihleikpairnqiirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkka
    gripeqilgkvsiavikgltylrekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlids
    mansfvgtrsymsperlqgthysvqsdiwsmglslvemavgrypipppdakelelmfgcq
    vegdaaetpprprapgrplasygmdsrppmaifelldyivnepppklpsgvfslefqdfv
    nkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstiglnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w8qA (A:)
    eleldeqqrkrleafltqkqkvgelkdddfekiselgagnggvvfkvshkpsglvmarkl
    ihleikpairnqiirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkka
    gripeqilgkvsiavikgltylrekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlids
    mansfvgtrsymsperlqgthysvqsdiwsmglslvemavgrypipppdakelelmfgcq
    rppmaifelldyivnepppklpsgvfslefqdfvnkcliknpaeradlkqlmvhafikrs
    daeevdfagwlcstigln