PDB entry 3w87

View 3w87 on RCSB PDB site
Description: Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with SH-1-103
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: Rossmann Fold, Oxidoreductase, Dihydroorotate/orotate and fumarate/succinate binding, Cytosol, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2013-03-12, released 2014-04-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Trypanosoma cruzi [TaxId:353153]
    Gene: PyrD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4D3W2 (1-313)
      • expression tag (0)
    Domains in SCOPe 2.07: d3w87a1, d3w87a2
  • Chain 'B':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Trypanosoma cruzi [TaxId:353153]
    Gene: PyrD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4D3W2 (1-313)
      • expression tag (0)
    Domains in SCOPe 2.07: d3w87b1, d3w87b2
  • Heterogens: W87, GOL, CAC, FMN, EDO, PEG, NCO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3w87A (A:)
    smclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpepry
    mafplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaq
    ekgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaa
    avlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyr
    rcpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgy
    rtleefrgrvktie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3w87B (B:)
    smclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpepry
    mafplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaq
    ekgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaa
    avlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyr
    rcpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgy
    rtleefrgrvktie