PDB entry 3w7n
View 3w7n on RCSB PDB site
Description: Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with TT2-3-149
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: Rossmann Fold, Oxidoreductase, Dihydroorotate/orotate and fumarate/succinate binding, Cytosol, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on
2013-03-02, released
2014-03-05
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-11-22, with a file datestamp of
2017-11-17.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.22
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Dihydroorotate dehydrogenase (fumarate)
Species: Trypanosoma cruzi [TaxId:353153]
Gene: PyrD
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3w7na_ - Chain 'B':
Compound: Dihydroorotate dehydrogenase (fumarate)
Species: Trypanosoma cruzi [TaxId:353153]
Gene: PyrD
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3w7nb_ - Heterogens: W7N, GOL, FMN, NCO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3w7nA (A:)
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3w7nB (B:)
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie