PDB entry 3w7j

View 3w7j on RCSB PDB site
Description: Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-6-040
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: Rossmann Fold, Oxidoreductase, Dihydroorotate/orotate and fumarate/succinate binding, Cytosol, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2013-02-28, released 2014-03-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.149
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Trypanosoma cruzi [TaxId:353153]
    Gene: PyrD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3w7ja_
  • Chain 'B':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Trypanosoma cruzi [TaxId:353153]
    Gene: PyrD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3w7jb_
  • Heterogens: W7J, GOL, FMN, NCO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3w7jA (A:)
    mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
    afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
    kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
    vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
    cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
    tleefrgrvktie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3w7jB (B:)
    mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
    afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
    kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
    vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
    cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
    tleefrgrvktie