PDB entry 3w69

View 3w69 on RCSB PDB site
Description: Crystal structure of human mdm2 with a dihydroimidazothiazole inhibitor
Class: ligase/ligase inhibitor
Keywords: Ubiquitin-protein ligase E3 Mdm2, p53, LIGASE-LIGASE INHIBITOR complex
Deposited on 2013-02-12, released 2013-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (2-86)
      • engineered mutation (10)
    Domains in SCOPe 2.07: d3w69a_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (2-86)
      • engineered mutation (10)
    Domains in SCOPe 2.07: d3w69b_
  • Heterogens: LTZ, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w69A (A:)
    gsetlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndll
    gdlfgvpsfsvkehrkiytmiyrnlvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w69A (A:)
    etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
    lfgvpsfsvkehrkiytmiyrnlvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3w69B (B:)
    gsetlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndll
    gdlfgvpsfsvkehrkiytmiyrnlvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w69B (B:)
    etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
    lfgvpsfsvkehrkiytmiyrnlvv