PDB entry 3w5u

View 3w5u on RCSB PDB site
Description: Cross-linked complex between Ferredoxin and Ferredoxin-NADP+ reductase
Class: electron transport
Keywords: electron transfer complex, ELECTRON TRANSPORT
Deposited on 2013-02-06, released 2013-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.229
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Zea mays [TaxId:4577]
    Gene: L-FNRI, ZEAMMB73_343560
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SLP6 (Start-313)
      • engineered mutation (18)
    Domains in SCOPe 2.07: d3w5ua1, d3w5ua2
  • Chain 'B':
    Compound: Ferredoxin-1, chloroplastic
    Species: Zea mays [TaxId:4577]
    Gene: FDX1, PFD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27787 (0-End)
      • engineered mutation (58)
    Domains in SCOPe 2.07: d3w5ub_
  • Chain 'C':
    Compound: ferredoxin
    Species: Zea mays [TaxId:4577]
    Gene: L-FNRI, ZEAMMB73_343560
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SLP6 (Start-313)
      • engineered mutation (18)
    Domains in SCOPe 2.07: d3w5uc1, d3w5uc2
  • Chain 'D':
    Compound: Ferredoxin-1, chloroplastic
    Species: Zea mays [TaxId:4577]
    Gene: FDX1, PFD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27787 (0-End)
      • engineered mutation (58)
    Domains in SCOPe 2.07: d3w5ud_
  • Chain 'E':
    Compound: ferredoxin
    Species: Zea mays [TaxId:4577]
    Gene: L-FNRI, ZEAMMB73_343560
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SLP6 (Start-313)
      • engineered mutation (18)
    Domains in SCOPe 2.07: d3w5ue1, d3w5ue2
  • Chain 'F':
    Compound: Ferredoxin-1, chloroplastic
    Species: Zea mays [TaxId:4577]
    Gene: FDX1, PFD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27787 (0-End)
      • engineered mutation (58)
    Domains in SCOPe 2.07: d3w5uf_
  • Chain 'G':
    Compound: ferredoxin
    Species: Zea mays [TaxId:4577]
    Gene: L-FNRI, ZEAMMB73_343560
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SLP6 (Start-313)
      • engineered mutation (18)
    Domains in SCOPe 2.07: d3w5ug1, d3w5ug2
  • Chain 'H':
    Compound: Ferredoxin-1, chloroplastic
    Species: Zea mays [TaxId:4577]
    Gene: FDX1, PFD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27787 (0-End)
      • engineered mutation (58)
    Domains in SCOPe 2.07: d3w5uh_
  • Heterogens: FAD, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w5uA (A:)
    iraqasaveapatakakkcskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhm
    vfstegkipyregqsigviadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliy
    tndageivkgvcsnflcdlqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsf
    lwkmffekhddykfnglgwlflgvptsssllykeefgkmkerapenfrvdyavsreqtna
    agermyiqtrmaeykeelwellkkdntyvymcglkgmekgiddimvslaekdgidwfdyk
    kqlkrgdqwnvevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w5uA (A:)
    cskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkipyregqsigv
    iadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivkgvcsnflcd
    lqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsflwkmffekhddykfnglg
    wlflgvptsssllykeefgkmkerapenfrvdyavsreqtnaagermyiqtrmaeykeel
    wellkkdntyvymcglkgmekgiddimvslaekdgidwfdykkqlkrgdqwnvevy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3w5uB (B:)
    atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqcd
    qsylddgqiadgwvltchayptsdvviethkeeeltga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w5uB (B:)
    atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqcd
    qsylddgqiadgwvltchayptsdvviethke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3w5uC (C:)
    iraqasaveapatakakkcskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhm
    vfstegkipyregqsigviadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliy
    tndageivkgvcsnflcdlqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsf
    lwkmffekhddykfnglgwlflgvptsssllykeefgkmkerapenfrvdyavsreqtna
    agermyiqtrmaeykeelwellkkdntyvymcglkgmekgiddimvslaekdgidwfdyk
    kqlkrgdqwnvevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w5uC (C:)
    cskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkipyregqsigv
    iadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivkgvcsnflcd
    lqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsflwkmffekhddykfnglg
    wlflgvptsssllykeefgkmkerapenfrvdyavsreqtnaagermyiqtrmaeykeel
    wellkkdntyvymcglkgmekgiddimvslaekdgidwfdykkqlkrgdqwnvevy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3w5uD (D:)
    atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqcd
    qsylddgqiadgwvltchayptsdvviethkeeeltga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w5uD (D:)
    atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqcd
    qsylddgqiadgwvltchayptsdvviethkeeel
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3w5uE (E:)
    iraqasaveapatakakkcskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhm
    vfstegkipyregqsigviadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliy
    tndageivkgvcsnflcdlqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsf
    lwkmffekhddykfnglgwlflgvptsssllykeefgkmkerapenfrvdyavsreqtna
    agermyiqtrmaeykeelwellkkdntyvymcglkgmekgiddimvslaekdgidwfdyk
    kqlkrgdqwnvevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w5uE (E:)
    cskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkipyregqsigv
    iadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivkgvcsnflcd
    lqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsflwkmffekhddykfnglg
    wlflgvptsssllykeefgkmkerapenfrvdyavsreqtnaagermyiqtrmaeykeel
    wellkkdntyvymcglkgmekgiddimvslaekdgidwfdykkqlkrgdqwnvevy
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3w5uF (F:)
    atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqcd
    qsylddgqiadgwvltchayptsdvviethkeeeltga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w5uF (F:)
    atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqcd
    qsylddgqiadgwvltchayptsdvviethkeee
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3w5uG (G:)
    iraqasaveapatakakkcskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhm
    vfstegkipyregqsigviadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliy
    tndageivkgvcsnflcdlqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsf
    lwkmffekhddykfnglgwlflgvptsssllykeefgkmkerapenfrvdyavsreqtna
    agermyiqtrmaeykeelwellkkdntyvymcglkgmekgiddimvslaekdgidwfdyk
    kqlkrgdqwnvevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w5uG (G:)
    cskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkipyregqsigv
    iadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivkgvcsnflcd
    lqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsflwkmffekhddykfnglg
    wlflgvptsssllykeefgkmkerapenfrvdyavsreqtnaagermyiqtrmaeykeel
    wellkkdntyvymcglkgmekgiddimvslaekdgidwfdykkqlkrgdqwnvevy
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3w5uH (H:)
    atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqcd
    qsylddgqiadgwvltchayptsdvviethkeeeltga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w5uH (H:)
    atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqcd
    qsylddgqiadgwvltchayptsdvviethke