PDB entry 3w5k

View 3w5k on RCSB PDB site
Description: Crystal structure of Snail1 and importin beta complex
Class: nuclear protein/metal binding protein
Keywords: Importin Beta, nuclear transport factor Snail1, transcription repressor, NUCLEAR PROTEIN-METAL BINDING PROTEIN complex
Deposited on 2013-01-30, released 2014-03-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.217
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Importin subunit beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: KPNB1, NTF97
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3w5ka_
  • Chain 'B':
    Compound: zinc finger protein snai1
    Species: Homo sapiens [TaxId:9606]
    Gene: SNAI1, SNAH
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w5kA (A:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
    ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
    kdcypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqda
    lqisdvvmasllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgiglkn
    yaeyqvclaavglvgdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdi
    alaiggefkkylevvlntlqqasqaqvdksdydmvdylnelrescleaytgivqglkgdq
    envhpdvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvear
    pmihelltegrrsktnkaktlatwatkelrklknqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w5kA (A:)
    rleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglqiknsltskdpdika
    qyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacaeipvnqwpelipqlv
    anvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqgmrkeepsnnvklaa
    tnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqnlvkimslyyqymet
    ymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieaseaaeqgrppehtskfy
    akgalqylvpiltqtltkqdendddddwnpckaagvclmllatcceddivphvlpfikeh
    iknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdpsvvvrdtaawtvgr
    icellpeaaindvylapllqclieglsaeprvasnvcwafsslaeaayeaaddqeepaty
    clsssfelivqkllettdrpdghqnnlrssayeslmeivknsakdcypavqkttlvimer
    lqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqdalqisdvvmasllrmfqs
    tagsggvqedalmavstlvevlggeflkymeafkpflgiglknyaeyqvclaavglvgdl
    cralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdialaiggefkkylevvln
    tlqqasqaqvdksdydmvdylnelrescleaytgivqglkgdqenvhpdvmlvqprvefi
    lsfidhiagdedhtdgvvacaagligdlctafgkdvlklvearpmihelltegrrsktnk
    aktlatwatkelrklknqa
    

  • Chain 'B':
    No sequence available.