PDB entry 3w5h

View 3w5h on RCSB PDB site
Description: Ultra-high resolution structure of NADH-cytochrome b5 reductase
Class: oxidoreductase
Keywords: Electron transfer, FAD binding, ER, OXIDOREDUCTASE
Deposited on 2013-01-30, released 2013-07-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 0.78 Å
R-factor: 0.126
AEROSPACI score: 1.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADH-cytochrome b5 reductase 3
    Species: Sus scrofa [TaxId:9823]
    Gene: CYB5R3, DIA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3w5ha1, d3w5ha2
  • Heterogens: FAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3w5hA (A:)
    stpaitlenpdikyplrlidkevvnhdtrrfrfalpspehilglpvgqhiylsaridgnl
    virpytpvssdddkgfvdlvikvyfkdthpkfpaggkmsqylesmkigdtiefrgpngll
    vyqgkgkfairpdkksspviktvksvgmiaggtgitpmlqviraimkdpddhtvchllfa
    nqtekdillrpeleelrnehsarfklwytvdrapeawdysqgfvneemirdhlpppeeep
    lvlmcgpppmiqyaclpnlervghpkercfaf