PDB entry 3w55

View 3w55 on RCSB PDB site
Description: The structure of ERK2 in complex with FR148083
Class: transferase/transferase inhibitor
Keywords: PROTEIN KINASE, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-01-21, released 2013-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.262
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3w55a_
  • Heterogens: 1FM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w55A (A:)
    gdlgsdelmaaaaaagagpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrva
    ikkispfehqtycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdl
    ykllktqhlsndhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglar
    vadpdhdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkh
    yldqlnhilgilgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldk
    mltfnphkrieveqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeeta
    rfqpgyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w55A (A:)
    pemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlr
    eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
    yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadvatrwyrapeimlns
    kgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedlnciinlkarn
    yllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpyleqyydpsde
    piaeapfkfdmelddlpkeklkelifeetarfqpg