PDB entry 3w4u

View 3w4u on RCSB PDB site
Description: Human zeta-2 beta-2-s hemoglobin
Class: oxygen transport
Keywords: globin fold, oxygen transport, oxygen binding, carbon mono-oxide bound, blood
Deposited on 2013-01-16, released 2013-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.205
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit zeta
    Species: Homo sapiens [TaxId:9606]
    Gene: HBZ, HBZ2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3w4ua_
  • Chain 'B':
    Compound: Hemoglobin subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: HBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68871 (Start-145)
      • engineered mutation (5)
    Domains in SCOPe 2.07: d3w4ub_
  • Chain 'C':
    Compound: Hemoglobin subunit zeta
    Species: Homo sapiens [TaxId:9606]
    Gene: HBZ, HBZ2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3w4uc_
  • Chain 'D':
    Compound: Hemoglobin subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: HBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68871 (Start-145)
      • engineered mutation (5)
    Domains in SCOPe 2.07: d3w4ud_
  • Chain 'E':
    Compound: Hemoglobin subunit zeta
    Species: Homo sapiens [TaxId:9606]
    Gene: HBZ, HBZ2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3w4ue_
  • Chain 'F':
    Compound: Hemoglobin subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: HBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68871 (Start-145)
      • engineered mutation (5)
    Domains in SCOPe 2.07: d3w4uf_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w4uA (A:)
    msltktertiivsmwakistqadtigtetlerlflshpqtktyfphfdlhpgsaqlrahg
    skvvaavgdavksiddiggalsklselhayilrvdpvnfkllshcllvtlaarfpadfta
    eahaawdkflsvvssvltekyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w4uA (A:)
    sltktertiivsmwakistqadtigtetlerlflshpqtktyfphfdlhpgsaqlrahgs
    kvvaavgdavksiddiggalsklselhayilrvdpvnfkllshcllvtlaarfpadftae
    ahaawdkflsvvssvltekyr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3w4uB (B:)
    vhltpveksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w4uB (B:)
    hltpveksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvk
    ahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgke
    ftppvqaayqkvvagvanalahkyh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3w4uC (C:)
    msltktertiivsmwakistqadtigtetlerlflshpqtktyfphfdlhpgsaqlrahg
    skvvaavgdavksiddiggalsklselhayilrvdpvnfkllshcllvtlaarfpadfta
    eahaawdkflsvvssvltekyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w4uC (C:)
    sltktertiivsmwakistqadtigtetlerlflshpqtktyfphfdlhpgsaqlrahgs
    kvvaavgdavksiddiggalsklselhayilrvdpvnfkllshcllvtlaarfpadftae
    ahaawdkflsvvssvltekyr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3w4uD (D:)
    vhltpveksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w4uD (D:)
    hltpveksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvk
    ahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgke
    ftppvqaayqkvvagvanalahkyh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3w4uE (E:)
    msltktertiivsmwakistqadtigtetlerlflshpqtktyfphfdlhpgsaqlrahg
    skvvaavgdavksiddiggalsklselhayilrvdpvnfkllshcllvtlaarfpadfta
    eahaawdkflsvvssvltekyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w4uE (E:)
    sltktertiivsmwakistqadtigtetlerlflshpqtktyfphfdlhpgsaqlrahgs
    kvvaavgdavksiddiggalsklselhayilrvdpvnfkllshcllvtlaarfpadftae
    ahaawdkflsvvssvlte
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3w4uF (F:)
    vhltpveksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w4uF (F:)
    hltpveksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvk
    ahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgke
    ftppvqaayqkvvagvanalahkyh