PDB entry 3w39

View 3w39 on RCSB PDB site
Description: Crystal structure of HLA-B*5201 in complexed with HIV immunodominant epitope (TAFTIPSI)
Class: immune system
Keywords: Class I Major Histocompatibility Complex, MHC, Membrane, IMMUNE SYSTEM
Deposited on 2012-12-13, released 2013-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.298
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: HLA class I histocompatibility antigen, B-52 alpha chain
  Species: Homo sapiens [TaxId:9606]
  Gene: HLA-B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30490 (1-276)
    • expression tag (0)
• Chain 'B':
  Compound: Beta-2-microglobulin
  Species: Homo sapiens [TaxId:9606]
  Gene: B2M
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61769 (1-99)
• Chain 'C':
  Compound: peptid from Gag-Pol polyprotein
  Species: Human immunodeficiency virus type 1 (Z2/CDC-Z34 ISOLATE), synthetic [TaxId:11683]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12499 (0-7)
• Chain 'D':
  Compound: HLA class I histocompatibility antigen, B-52 alpha chain
  Species: Homo sapiens [TaxId:9606]
  Gene: HLA-B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30490 (1-276)
    • expression tag (0)
  Domains in SCOPe 2.07: d3w39d1, d3w39d2, d3w39d3
• Chain 'E':
  Compound: Beta-2-microglobulin
  Species: Homo sapiens [TaxId:9606]
  Gene: B2M
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61769 (1-99)
• Chain 'F':
  Compound: peptid from Gag-Pol polyprotein
  Species: Human immunodeficiency virus type 1 (Z2/CDC-Z34 ISOLATE), synthetic [TaxId:11683]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12499 (0-7)

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3w39D (D:)
  mgshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpey
  wdretqisktntqtyrenlrialryynqseagshtwqtmygcdvgpdgrllrghnqyayd
  gkdyialnedlsswtaadtaaqitqrkweaareaeqlrayleglcvewlrrhlengketl
  qradppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdr
  tfqkwaavvvpsgeeqrytchvqheglpkpltlrwep
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.