PDB entry 3w39

View 3w39 on RCSB PDB site
Description: Crystal structure of HLA-B*5201 in complexed with HIV immunodominant epitope (TAFTIPSI)
Class: immune system
Keywords: Class I Major Histocompatibility Complex, MHC, Membrane, IMMUNE SYSTEM
Deposited on 2012-12-13, released 2013-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.298
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HLA class I histocompatibility antigen, B-52 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30490 (1-276)
      • expression tag (0)
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: peptid from Gag-Pol polyprotein
    Species: Human immunodeficiency virus type 1 (Z2/CDC-Z34 ISOLATE), synthetic [TaxId:11683]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: HLA class I histocompatibility antigen, B-52 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30490 (1-276)
      • expression tag (0)
    Domains in SCOPe 2.08: d3w39d1, d3w39d2, d3w39d3
  • Chain 'E':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: peptid from Gag-Pol polyprotein
    Species: Human immunodeficiency virus type 1 (Z2/CDC-Z34 ISOLATE), synthetic [TaxId:11683]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3w39D (D:)
    mgshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpey
    wdretqisktntqtyrenlrialryynqseagshtwqtmygcdvgpdgrllrghnqyayd
    gkdyialnedlsswtaadtaaqitqrkweaareaeqlrayleglcvewlrrhlengketl
    qradppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdr
    tfqkwaavvvpsgeeqrytchvqheglpkpltlrwep
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.