PDB entry 3w38

View 3w38 on RCSB PDB site
Description: Sugar beet alpha-glucosidase
Class: hydrolase, carbohydrate
Keywords: alpha-glucosidase, glycoside hydrolase family 31, (beta/alpha)8-barrel, HYDROLASE, CARBOHYDRATE
Deposited on 2012-12-13, released 2013-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-30, with a file datestamp of 2014-07-25.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: 0.229
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-glucosidase
    Species: Beta vulgaris [TaxId:161934]
    Database cross-references and differences (RAF-indexed):
    • PDB 3W38
    Domains in SCOPe 2.07: d3w38a1, d3w38a2, d3w38a3, d3w38a4
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w38A (A:)
    mersklpryicatlavvlplvlcmvvegattskndnqgeaigygyqvknakvdnstgksl
    tallqlirnspvygpdiqflsftasfeeddtlriritdannrrweipnevlprpppppsp
    pplsslqhlpkpipqnqptttvlshphsdlvftlfhttpfgftiyrksthdvlfdatpip
    snpttfliykdqylqlssslpaqqahlyglgehtkptfqlahnqiltlwnadiasfnrdl
    nlygshpfymdvrsspmvgsthgvfllnsngmdveytgdritykviggiidlyifagrtp
    emvldqytkligrpapmpywafgfhqcrwgyrdvneietvvdkyaeariplevmwtdidy
    mdafkdftldpvhfpldkmqqfvtklhrngqryvpildpgintnksygtfirgmqsnvfi
    krdgnpylgsvwpgpvyypdfldpaarsfwvdeikrfrdilpidgiwidmneasnfitsa
    ptpgstldnppykinnsggrvpinsktipatamhygnvteynahnlygflesqatrealv
    rtsnerpfllsrstfagsgkytahwtgdnaarwddlqysiptmlnfglfgmpmigadicg
    faestteelcrrwiqlgafypfsrdhsardtthqelylwesvaasartvlglryqllpyy
    ytlmydanlrgipiarplfftfpddvatygissqfligrgimvspvlqpgavsvnayfpr
    gnwfslfnytssvsvsagtyvslsappdhinvhihegnivamqgeamttqaarstpfhll
    vvmsdhvastgelfldngiemdiggpggkwtlvrffaesginnltissevvnrgyamsqr
    wvmdkitilglkrrvrikeytvqkdagaikikglglrtsshnqggfvvsvisdlrqlvgq
    afklelefegatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w38A (A:)
    eaigygyqvknakvdnstgksltallqlirnspvygpdiqflsftasfeeddtlriritd
    annrrweipnevlprpppppptttvlshphsdlvftlfhttpfgftiyrksthdvlfdat
    pipsnpttfliykdqylqlssslpaqqahlyglgehtkptfqlahnqiltlwnadiasfn
    rdlnlygshpfymdvrsspmvgsthgvfllnsngmdveytgdritykviggiidlyifag
    rtpemvldqytkligrpapmpywafgfhqcrwgyrdvneietvvdkyaeariplevmwtd
    idymdafkdftldpvhfpldkmqqfvtklhrngqryvpildpgintnksygtfirgmqsn
    vfikrdgnpylgsvwpgpvyypdfldpaarsfwvdeikrfrdilpidgiwidmneasnfi
    tsaptpgstldnppykinnsggrvpinsktipatamhygnvteynahnlygflesqatre
    alvrtsnerpfllsrstfagsgkytahwtgdnaarwddlqysiptmlnfglfgmpmigad
    icgfaestteelcrrwiqlgafypfsrdhsardtthqelylwesvaasartvlglryqll
    pyyytlmydanlrgipiarplfftfpddvatygissqfligrgimvspvlqpgavsvnay
    fprgnwfslfnytssvsvsagtyvslsappdhinvhihegnivamqgeamttqaarstpf
    hllvvmsdhvastgelfldngiemdiggpggkwtlvrffaesginnltissevvnrgyam
    sqrwvmdkitilglkrrvrikgfvvsvisdlrqlvgqafklelefe