PDB entry 3w33

View 3w33 on RCSB PDB site
Description: EGFR kinase domain complexed with compound 19b
Class: transferase/transferase inhibitor
Keywords: anti-oncogene, cell cycle, disease mutation, kinase domain, receptor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-12-07, released 2013-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.199
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3w33a_
  • Heterogens: W19, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w33A (A:)
    gamgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp
    tdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w33A (A:)
    qallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelrkankeildeayv
    masvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqiakgm
    nyledrrlvhrdlaarnvlvktpqhvkitdfglakllkvpikwmalesilhriythqsdv
    wsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmidads
    rpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdddvvdadeyli