PDB entry 3w31

View 3w31 on RCSB PDB site
Description: Structual basis for the recognition of Ubc13 by the Shigella flexneri effector OspI
Class: immune system
Keywords: Type 3 secretion system, Effector, Deamidation, IMMUNE SYSTEM
Deposited on 2012-12-07, released 2013-03-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: 0.245
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ORF169b
    Species: Shigella flexneri [TaxId:623]
    Gene: ORF169b, CP0209
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VSD5 (Start-219)
      • engineered mutation (69)
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2N, BLU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3w31b_
  • Heterogens: IOD

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3w31B (B:)
    gshmaglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelf
    lpeeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnp
    ddplandvaeqwktneaqaietarawtrlyamnni
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w31B (B:)
    maglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpe
    eypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddp
    landvaeqwktneaqaietarawtrlyamnni