PDB entry 3w22

View 3w22 on RCSB PDB site
Description: Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-125
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: Rossmann Fold, Oxidoreductase, Dihydroorotate/orotate binding, Cytosol, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2012-11-26, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.166
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Trypanosoma cruzi [TaxId:353153]
    Gene: PyrD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3w22a_
  • Chain 'B':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Trypanosoma cruzi [TaxId:353153]
    Gene: PyrD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3w22b_
  • Heterogens: 2RO, GOL, FMN, NCO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3w22A (A:)
    mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
    afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
    kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
    vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
    cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
    tleefrgrvktie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3w22B (B:)
    mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
    afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
    kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
    vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
    cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
    tleefrgrvktie