PDB entry 3w1s

View 3w1s on RCSB PDB site
Description: Crystal structure of Saccharomyces cerevisiae Atg12-Atg5 conjugate bound to the N-terminal domain of Atg16
Class: ligase
Keywords: Ubiquitin fold, E3-like, Atg3 binding, Isopeptide bond between Atg12 Gly186 and Atg5 Lys149, LIGASE
Deposited on 2012-11-20, released 2012-12-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.231
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Autophagy protein 5
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: APG5, ATG5, Atg5(amino acids 1-284), P2601, YPL149W
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Autophagy protein 16
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: APG15, APG16, ATG16, Atg16(amino acids 1-46), CVT11, SAP18, YM8520.08C, YMR159C
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ubiquitin-like protein ATG12
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: APG12, ATG12, Atg12(amino acids 100-186), YBR1506, YBR217W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3w1sc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3w1sC (C:)
    gahmniqkiqikfqpigsigqlkpsvckismsqsfamvilflkrrlkmdhvycyinnsfa
    pspqqnigelwmqfktndelivsycasvafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w1sC (C:)
    iqkiqikfqpigsvckismsqsfamvilflkrrlkmdhvycyinnsfapspqqnigelwm
    qfktndelivsycafg