PDB entry 3w1q

View 3w1q on RCSB PDB site
Description: Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with NL-2
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: Rossmann Fold, Oxidoreductase, Dihydroorotate/orotate binding, Cytosol, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2012-11-20, released 2013-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.153
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Trypanosoma cruzi [TaxId:353153]
    Gene: PyrD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3w1qa_
  • Chain 'B':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Trypanosoma cruzi [TaxId:353153]
    Gene: PyrD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3w1qb_
  • Heterogens: FMN, NCO, YRO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3w1qA (A:)
    mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
    afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
    kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
    vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
    cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
    tleefrgrvktie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3w1qB (B:)
    mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
    afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
    kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
    vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
    cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
    tleefrgrvktie