PDB entry 3w1m

View 3w1m on RCSB PDB site
Description: Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with 5-bromoorotate
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: Rossmann Fold, Oxidoreductase, Dihydroorotate/orotate binding, Cytosol, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2012-11-16, released 2013-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.145
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Trypanosoma cruzi [TaxId:353153]
    Gene: PyrD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3w1ma_
  • Chain 'B':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Trypanosoma cruzi [TaxId:353153]
    Gene: PyrD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3w1mb_
  • Heterogens: FMN, NCO, RRO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3w1mA (A:)
    mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
    afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
    kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
    vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
    cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
    tleefrgrvktie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3w1mB (B:)
    mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
    afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
    kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
    vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
    cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
    tleefrgrvktie