PDB entry 3w15

View 3w15 on RCSB PDB site
Description: Structure of peroxisomal targeting signal 2 (PTS2) of Saccharomyces cerevisiae 3-ketoacyl-CoA thiolase in complex with Pex7p and Pex21p
Class: Protein Transport
Keywords: beta-propeller, targeting signal recognition, cytosol, peroxisome, Protein Transport
Deposited on 2012-11-06, released 2013-07-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.191
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisomal targeting signal 2 receptor
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: PEX7
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Peroxisomal membrane protein PEX21
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: PEX21
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 3-ketoacyl-CoA thiolase, peroxisomal, Maltose-binding periplasmic protein
    Species: Saccharomyces cerevisiae, Escherichia coli [TaxId:559292, 83333]
    Gene: FOX3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27796 (2-16)
      • expression tag (0-1)
    • Uniprot P0AEX9 (19-388)
      • linker (17-18)
    Domains in SCOPe 2.03: d3w15c_
  • Heterogens: NO3, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3w15C (C:)
gsmsqrlqsikdhlvesrskieegklviwingdkgynglaevgkkfekdtgikvtvehpd
kleekfpqvaatgdgpdiifwahdrfggyaqsgllaeitpdkafqdklypftwdavryng
kliaypiavealsliynkdllpnppktweeipaldkelkakgksalmfnlqepyftwpli
aadggyafkyengkydikdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkge
tamtingpwawsnidtskvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakefle
nylltdegleavnkdkplgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwy
avrtavinaasgrqtvdealkdaqtritk