PDB entry 3w0c

View 3w0c on RCSB PDB site
Description: Crystal Structure Analysis of Vitamin D receptor
Class: hormone receptor
Keywords: Vitamin D receptor, HORMONE RECEPTOR
Deposited on 2012-10-29, released 2013-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Vdr, Nr1i1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3w0ca_
  • Heterogens: 6DS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w0cA (A:)
    lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
    adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
    qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
    lieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpec
    smkltplvlevfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w0cA (A:)
    lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
    adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
    qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
    lieaiqdrlsntlqtyircrhpppllyakmiqkladlrslneehskqyrclsfqpecsmk
    ltplvlevfg