PDB entry 3w07

View 3w07 on RCSB PDB site
Description: Atomic resolution structure of orotidine 5'-monophosphate decarboxylase from Methanothermobacter thermoautotrophicus bound with UMP.
Class: lyase
Keywords: Orotidine 5'-monophosphate decarboxylase, LYASE
Deposited on 2012-10-22, released 2013-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.03 Å
R-factor: N/A
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • see remark 999 (103)
    Domains in SCOPe 2.07: d3w07a_
  • Heterogens: U5P, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w07A (A:)
    gshmrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiia
    efrkrfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemg
    revflltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsfl
    ispgvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdlripedpaankar
    keaelaaataeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w07A (A:)
    vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
    fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
    aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
    etlrfadaiivgrsiyladnpaaaaagiiesikdl