PDB entry 3w02

View 3w02 on RCSB PDB site
Description: Crystal structure of PcrB complexed with SO4 from Staphylococcus aureus subsp. aureus Mu3
Class: transferase
Keywords: biosynthesis, prenyltransferases, enzyme catalysis, TRANSFERASE
Deposited on 2012-10-17, released 2012-12-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: 0.194
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heptaprenylglyceryl phosphate synthase
    Species: Staphylococcus aureus [TaxId:418127]
    Gene: pcrB
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7X435 (5-End)
      • expression tag (3-4)
    Domains in SCOPe 2.05: d3w02a_
  • Chain 'B':
    Compound: Heptaprenylglyceryl phosphate synthase
    Species: Staphylococcus aureus [TaxId:418127]
    Gene: pcrB
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7X435 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.05: d3w02b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3w02A (A:)
    agagamydikkwrhifkldpakhisdddldaicmsqtdaimiggtddvtednvihlmski
    rryplplvleisniesvmpgfdfyfvptvlnstdvafhngtllealktyghsidfeevif
    egyvvcnadskvakhtkantdlttedleayaqmvnhmyrlpvmyieysgiygdvskvqav
    sehltetqlfygggisseqqatemaaiadtiivgdiiykdikkalktvkikessk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w02A (A:)
    gamydikkwrhifkldpakhisdddldaicmsqtdaimiggtddvtednvihlmskirry
    plplvleisniesvmpgfdfyfvptvlnstdvafhngtllealktyghsidfeevifegy
    vvcnadskvakhtkantdlttedleayaqmvnhmyrlpvmyieysgiygdvskvqavseh
    ltetqlfygggisseqqatemaaiadtiivgdiiykdikkalktvki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3w02B (B:)
    agagamydikkwrhifkldpakhisdddldaicmsqtdaimiggtddvtednvihlmski
    rryplplvleisniesvmpgfdfyfvptvlnstdvafhngtllealktyghsidfeevif
    egyvvcnadskvakhtkantdlttedleayaqmvnhmyrlpvmyieysgiygdvskvqav
    sehltetqlfygggisseqqatemaaiadtiivgdiiykdikkalktvkikessk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3w02B (B:)
    amydikkwrhifkldpakhisdddldaicmsqtdaimiggtddvtednvihlmskirryp
    lplvleisniesvmpgfdfyfvptvlnstdvafhngtllealktyghsidfeevifegyv
    vcnadskvakhtkantdlttedleayaqmvnhmyrlpvmyieysgiygdvskvqavsehl
    tetqlfygggisseqqatemaaiadtiivgdiiykdikkalktvkik