PDB entry 3vzv

View 3vzv on RCSB PDB site
Description: Crystal structure of human mdm2 with a dihydroimidazothiazole inhibitor
Class: ligase/ligase inhibitor
Keywords: Ubiquitin-protein ligase E3 Mdm2, p53, LIGASE-LIGASE INHIBITOR complex
Deposited on 2012-10-16, released 2013-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.25
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (2-86)
      • engineered mutation (10)
    Domains in SCOPe 2.07: d3vzva_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (2-86)
      • engineered mutation (10)
    Domains in SCOPe 2.07: d3vzvb_
  • Heterogens: VZV

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vzvA (A:)
    gsetlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndll
    gdlfgvpsfsvkehrkiytmiyrnlvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vzvA (A:)
    etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
    lfgvpsfsvkehrkiytmiyrnlvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vzvB (B:)
    gsetlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndll
    gdlfgvpsfsvkehrkiytmiyrnlvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vzvB (B:)
    etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
    lfgvpsfsvkehrkiytmiyrnlvv