PDB entry 3vzp

View 3vzp on RCSB PDB site
Description: Crystal structure of PhaB from Ralstonia eutropha
Class: oxidoreductase
Keywords: alpha/beta structure, OXIDOREDUCTASE
Deposited on 2012-10-15, released 2013-08-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.194
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetoacetyl-CoA reductase
    Species: Cupriavidus necator [TaxId:381666]
    Gene: phbB, H16_A1439
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3vzpa_
  • Chain 'B':
    Compound: Acetoacetyl-CoA reductase
    Species: Cupriavidus necator [TaxId:381666]
    Gene: phbB, H16_A1439
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14697 (12-256)
      • expression tag (8-11)
    Domains in SCOPe 2.05: d3vzpb_
  • Chain 'C':
    Compound: Acetoacetyl-CoA reductase
    Species: Cupriavidus necator [TaxId:381666]
    Gene: phbB, H16_A1439
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3vzpc_
  • Chain 'D':
    Compound: Acetoacetyl-CoA reductase
    Species: Cupriavidus necator [TaxId:381666]
    Gene: phbB, H16_A1439
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14697 (12-256)
      • expression tag (8-11)
    Domains in SCOPe 2.05: d3vzpd_
  • Heterogens: SO4, GOL, DIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vzpA (A:)
    mrgshhhhhhgstqriayvtggmggigtaicqrlakdgfrvvagcgpnsprrekwleqqk
    algfdfiasegnvadwdstktafdkvksevgevdvlinnagitrdvvfrkmtradwdavi
    dtnltslfnvtkqvidgmadrgwgrivnissvngqkgqfgqtnystakaglhgftmalaq
    evatkgvtvntvspgyiatdmvkairqdvldkivatipvkrlglpeeiasicawlssees
    gfstgadfslngglhmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vzpA (A:)
    tqriayvtggmggigtaicqrlakdgfrvvagcgpnsprrekwleqqkalgfdfiasegn
    vadwdstktafdkvksevgevdvlinnagitrdvvfrkmtradwdavidtnltslfnvtk
    qvidgmadrgwgrivnissvngqkgqfgqtnystakaglhgftmalaqevatkgvtvntv
    spgyiatdmvkairqdvldkivatipvkrlglpeeiasicawlsseesgfstgadfslng
    glhmg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vzpB (B:)
    mrgshhhhhhgstqriayvtggmggigtaicqrlakdgfrvvagcgpnsprrekwleqqk
    algfdfiasegnvadwdstktafdkvksevgevdvlinnagitrdvvfrkmtradwdavi
    dtnltslfnvtkqvidgmadrgwgrivnissvngqkgqfgqtnystakaglhgftmalaq
    evatkgvtvntvspgyiatdmvkairqdvldkivatipvkrlglpeeiasicawlssees
    gfstgadfslngglhmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vzpB (B:)
    hhgstqriayvtggmggigtaicqrlakdgfrvvagcgpnsprrekwleqqkalgfdfia
    segnvadwdstktafdkvksevgevdvlinnagitrdvvfrkmtradwdavidtnltslf
    nvtkqvidgmadrgwgrivnissvngqkgqfgqtnystakaglhgftmalaqevatkgvt
    vntvspgyiatdmvkairqdvldkivatipvkrlglpeeiasicawlsseesgfstgadf
    slngglhmg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3vzpC (C:)
    mrgshhhhhhgstqriayvtggmggigtaicqrlakdgfrvvagcgpnsprrekwleqqk
    algfdfiasegnvadwdstktafdkvksevgevdvlinnagitrdvvfrkmtradwdavi
    dtnltslfnvtkqvidgmadrgwgrivnissvngqkgqfgqtnystakaglhgftmalaq
    evatkgvtvntvspgyiatdmvkairqdvldkivatipvkrlglpeeiasicawlssees
    gfstgadfslngglhmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vzpC (C:)
    qriayvtggmggigtaicqrlakdgfrvvagcgpnsprrekwleqqkalgfdfiasegnv
    adwdstktafdkvksevgevdvlinnagitrdvvfrkmtradwdavidtnltslfnvtkq
    vidgmadrgwgrivnissvngqkgqfgqtnystakaglhgftmalaqevatkgvtvntvs
    pgyiatdmvkairqdvldkivatipvkrlglpeeiasicawlsseesgfstgadfslngg
    lhmg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3vzpD (D:)
    mrgshhhhhhgstqriayvtggmggigtaicqrlakdgfrvvagcgpnsprrekwleqqk
    algfdfiasegnvadwdstktafdkvksevgevdvlinnagitrdvvfrkmtradwdavi
    dtnltslfnvtkqvidgmadrgwgrivnissvngqkgqfgqtnystakaglhgftmalaq
    evatkgvtvntvspgyiatdmvkairqdvldkivatipvkrlglpeeiasicawlssees
    gfstgadfslngglhmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vzpD (D:)
    hhgstqriayvtggmggigtaicqrlakdgfrvvagcgpnsprrekwleqqkalgfdfia
    segnvadwdstktafdkvksevgevdvlinnagitrdvvfrkmtradwdavidtnltslf
    nvtkqvidgmadrgwgrivnissvngqkgqfgqtnystakaglhgftmalaqevatkgvt
    vntvspgyiatdmvkairqdvldkivatipvkrlglpeeiasicawlsseesgfstgadf
    slngglhmg